KEGG   Homo sapiens (human): 6934Help
Entry
6934              CDS       T01001                                 

Gene name
TCF7L2, TCF-4, TCF4
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing's syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to Wnt signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to Wnt signaling pathway
N00258  Mutation-inactivated CDH1 to Wnt signaling pathway
Disease
H00409  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6934 (TCF7L2)
   04390 Hippo signaling pathway
    6934 (TCF7L2)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    6934 (TCF7L2)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    6934 (TCF7L2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6934 (TCF7L2)
   05210 Colorectal cancer
    6934 (TCF7L2)
   05225 Hepatocellular carcinoma
    6934 (TCF7L2)
   05226 Gastric cancer
    6934 (TCF7L2)
   05216 Thyroid cancer
    6934 (TCF7L2)
   05221 Acute myeloid leukemia
    6934 (TCF7L2)
   05217 Basal cell carcinoma
    6934 (TCF7L2)
   05215 Prostate cancer
    6934 (TCF7L2)
   05213 Endometrial cancer
    6934 (TCF7L2)
   05224 Breast cancer
    6934 (TCF7L2)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6934 (TCF7L2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    6934 (TCF7L2)
  Infectious diseases
   05165 Human papillomavirus infection
    6934 (TCF7L2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    6934 (TCF7L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 6934
NCBI-ProteinID: NP_001139746
OMIM: 602228
HGNC: 11641
Ensembl: ENSG00000148737
Vega: OTTHUMG00000019070
Pharos: Q9NQB0(Tbio)
UniProt: Q9NQB0
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q25.2-q25.3
AA seq 602 aa AA seqDB search
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCL
SPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLL
AEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKS
LE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagacaaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcaccg
gcacacattgtctctaacaaagtgccagtggtgcagcaccctcaccatgtccaccccctc
acgcctcttatcacgtacagcaatgaacacttcacgccgggaaacccacctccacactta
ccagccgacgtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatcc
ccgtattacccactatcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcaaccagtgtacccaatcacgacaggaggattcagacacccctac
cccacagctctgaccgtcaatgcttccatgtccaggttccctccccatatggtcccacca
catcatacgctacacacgacgggcattccgcatccggccatagtcacaccaacagtcaaa
caggaatcgtcccagagtgatgtcggctcactccatagttcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagagcaaaggtcgtagctgagtgcacgttgaaagaaagcgcggccatc
aaccagatccttgggcggaggtggcatgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcatatgcaactgtaccccggctggtccgcgcgg
gataactatggaaagaagaagaagaggaaaagggacaagcagccgggagagaccaatgat
gcaaatactccaaagaagtgtcgggcactgttcgggcttgaccgacagactttatggtgc
aaaccgtgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctc
agcccaccctcttcagatggaagcttactagattcgcctcccccctccccgaacctgcta
ggctcccctccccgagacgccaagtcacagactgagcagacccagcctctgtcgctgtcc
ctgaagcccgaccccctggcccacctgtccatgatgcctccgccacccgccctcctgctc
gctgaggccacccacaaggcctccgccctctgtcccaacggggccctggacctgccccca
gccgctttgcagcctgccgccccctcctcatcaattgcacagccgtcgacttcttcctta
cattcccacagctccctggccgggacccagccccagccgctgtcgctcgtcaccaagtct
ttagaatag

DBGET integrated database retrieval system