KEGG   Homo sapiens (human): 6934Help
Entry
6934              CDS       T01001                                 

Gene name
TCF7L2, TCF-4, TCF4
Definition
transcription factor 7-like 2 (T-cell specific, HMG-box)
Orthology
K04491  
transcription factor 7-like 2
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Adherens junction
Melanogenesis
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
Wnt signaling
Disease
H00409  
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6934 (TCF7L2)
   04390 Hippo signaling pathway
    6934 (TCF7L2)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    6934 (TCF7L2)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    6934 (TCF7L2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6934 (TCF7L2)
   05210 Colorectal cancer
    6934 (TCF7L2)
   05216 Thyroid cancer
    6934 (TCF7L2)
   05221 Acute myeloid leukemia
    6934 (TCF7L2)
   05217 Basal cell carcinoma
    6934 (TCF7L2)
   05215 Prostate cancer
    6934 (TCF7L2)
   05213 Endometrial cancer
    6934 (TCF7L2)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6934 (TCF7L2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    6934 (TCF7L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q25.3
AA seq 602 aa AA seqDB search
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCL
SPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLL
AEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKS
LE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagacaaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcaccg
gcacacattgtctctaacaaagtgccagtggtgcagcaccctcaccatgtccaccccctc
acgcctcttatcacgtacagcaatgaacacttcacgccgggaaacccacctccacactta
ccagccgacgtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatcc
ccgtattacccactatcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcaaccagtgtacccaatcacgacaggaggattcagacacccctac
cccacagctctgaccgtcaatgcttccatgtccaggttccctccccatatggtcccacca
catcatacgctacacacgacgggcattccgcatccggccatagtcacaccaacagtcaaa
caggaatcgtcccagagtgatgtcggctcactccatagttcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagagcaaaggtcgtagctgagtgcacgttgaaagaaagcgcggccatc
aaccagatccttgggcggaggtggcatgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcatatgcaactgtaccccggctggtccgcgcgg
gataactatggaaagaagaagaagaggaaaagggacaagcagccgggagagaccaatgat
gcaaatactccaaagaagtgtcgggcactgttcgggcttgaccgacagactttatggtgc
aaaccgtgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctc
agcccaccctcttcagatggaagcttactagattcgcctcccccctccccgaacctgcta
ggctcccctccccgagacgccaagtcacagactgagcagacccagcctctgtcgctgtcc
ctgaagcccgaccccctggcccacctgtccatgatgcctccgccacccgccctcctgctc
gctgaggccacccacaaggcctccgccctctgtcccaacggggccctggacctgccccca
gccgctttgcagcctgccgccccctcctcatcaattgcacagccgtcgacttcttcctta
cattcccacagctccctggccgggacccagccccagccgctgtcgctcgtcaccaagtct
ttagaatag

DBGET integrated database retrieval system