KEGG   Homo sapiens (human): 7015Help
Entry
7015              CDS       T01001                                 

Gene name
TERT, CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, hTRT
Definition
(RefSeq) telomerase reverse transcriptase (EC:2.7.7.49)
  KO
K11126  
telomerase reverse transcriptase [EC:2.7.7.49]
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Disease
H00507  
Dyskeratosis congenita (DC)
H00764  
Cri du chat syndrome
H01132  
Aplastic anemia (AA)
H01299  
Idiopathic pulmonary fibrosis
H01667  
Medulloblastoma
Drug target
Imetelstat sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    7015 (TERT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     7015 (TERT)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    7015 (TERT)
   Telomerase complex (fungi)
    7015 (TERT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5p15.33
AA seq 1132 aa AA seqDB search
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgctccccgctgccgagccgtgcgctccctgctgcgcagccactaccgcgag
gtgctgccgctggccacgttcgtgcggcgcctggggccccagggctggcggctggtgcag
cgcggggacccggcggctttccgcgcgctggtggcccagtgcctggtgtgcgtgccctgg
gacgcacggccgccccccgccgccccctccttccgccaggtgtcctgcctgaaggagctg
gtggcccgagtgctgcagaggctgtgcgagcgcggcgcgaagaacgtgctggccttcggc
ttcgcgctgctggacggggcccgcgggggcccccccgaggccttcaccaccagcgtgcgc
agctacctgcccaacacggtgaccgacgcactgcgggggagcggggcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctggttcacctgctggcacgctgcgcgctctttgtg
ctggtggctcccagctgcgcctaccaggtgtgcgggccgccgctgtaccagctcggcgct
gccactcaggcccggcccccgccacacgctagtggaccccgaaggcgtctgggatgcgaa
cgggcctggaaccatagcgtcagggaggccggggtccccctgggcctgccagccccgggt
gcgaggaggcgcgggggcagtgccagccgaagtctgccgttgcccaagaggcccaggcgt
ggcgctgcccctgagccggagcggacgcccgttgggcaggggtcctgggcccacccgggc
aggacgcgtggaccgagtgaccgtggtttctgtgtggtgtcacctgccagacccgccgaa
gaagccacctctttggagggtgcgctctctggcacgcgccactcccacccatccgtgggc
cgccagcaccacgcgggccccccatccacatcgcggccaccacgtccctgggacacgcct
tgtcccccggtgtacgccgagaccaagcacttcctctactcctcaggcgacaaggagcag
ctgcggccctccttcctactcagctctctgaggcccagcctgactggcgctcggaggctc
gtggagaccatctttctgggttccaggccctggatgccagggactccccgcaggttgccc
cgcctgccccagcgctactggcaaatgcggcccctgtttctggagctgcttgggaaccac
gcgcagtgcccctacggggtgctcctcaagacgcactgcccgctgcgagctgcggtcacc
ccagcagccggtgtctgtgcccgggagaagccccagggctctgtggcggcccccgaggag
gaggacacagacccccgtcgcctggtgcagctgctccgccagcacagcagcccctggcag
gtgtacggcttcgtgcgggcctgcctgcgccggctggtgcccccaggcctctggggctcc
aggcacaacgaacgccgcttcctcaggaacaccaagaagttcatctccctggggaagcat
gccaagctctcgctgcaggagctgacgtggaagatgagcgtgcgggactgcgcttggctg
cgcaggagcccaggggttggctgtgttccggccgcagagcaccgtctgcgtgaggagatc
ctggccaagttcctgcactggctgatgagtgtgtacgtcgtcgagctgctcaggtctttc
ttttatgtcacggagaccacgtttcaaaagaacaggctctttttctaccggaagagtgtc
tggagcaagttgcaaagcattggaatcagacagcacttgaagagggtgcagctgcgggag
ctgtcggaagcagaggtcaggcagcatcgggaagccaggcccgccctgctgacgtccaga
ctccgcttcatccccaagcctgacgggctgcggccgattgtgaacatggactacgtcgtg
ggagccagaacgttccgcagagaaaagagggccgagcgtctcacctcgagggtgaaggca
ctgttcagcgtgctcaactacgagcgggcgcggcgccccggcctcctgggcgcctctgtg
ctgggcctggacgatatccacagggcctggcgcaccttcgtgctgcgtgtgcgggcccag
gacccgccgcctgagctgtactttgtcaaggtggatgtgacgggcgcgtacgacaccatc
ccccaggacaggctcacggaggtcatcgccagcatcatcaaaccccagaacacgtactgc
gtgcgtcggtatgccgtggtccagaaggccgcccatgggcacgtccgcaaggccttcaag
agccacgtctctaccttgacagacctccagccgtacatgcgacagttcgtggctcacctg
caggagaccagcccgctgagggatgccgtcgtcatcgagcagagctcctccctgaatgag
gccagcagtggcctcttcgacgtcttcctacgcttcatgtgccaccacgccgtgcgcatc
aggggcaagtcctacgtccagtgccaggggatcccgcagggctccatcctctccacgctg
ctctgcagcctgtgctacggcgacatggagaacaagctgtttgcggggattcggcgggac
gggctgctcctgcgtttggtggatgatttcttgttggtgacacctcacctcacccacgcg
aaaaccttcctcaggaccctggtccgaggtgtccctgagtatggctgcgtggtgaacttg
cggaagacagtggtgaacttccctgtagaagacgaggccctgggtggcacggcttttgtt
cagatgccggcccacggcctattcccctggtgcggcctgctgctggatacccggaccctg
gaggtgcagagcgactactccagctatgcccggacctccatcagagccagtctcaccttc
aaccgcggcttcaaggctgggaggaacatgcgtcgcaaactctttggggtcttgcggctg
aagtgtcacagcctgtttctggatttgcaggtgaacagcctccagacggtgtgcaccaac
atctacaagatcctcctgctgcaggcgtacaggtttcacgcatgtgtgctgcagctccca
tttcatcagcaagtttggaagaaccccacatttttcctgcgcgtcatctctgacacggcc
tccctctgctactccatcctgaaagccaagaacgcagggatgtcgctgggggccaagggc
gccgccggccctctgccctccgaggccgtgcagtggctgtgccaccaagcattcctgctc
aagctgactcgacaccgtgtcacctacgtgccactcctggggtcactcaggacagcccag
acgcagctgagtcggaagctcccggggacgacgctgactgccctggaggccgcagccaac
ccggcactgccctcagacttcaagaccatcctggactga

DBGET integrated database retrieval system