KEGG   Homo sapiens (human): 7015Help
Entry
7015              CDS       T01001                                 

Gene name
TERT, CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, hTRT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  
telomerase reverse transcriptase [EC:2.7.7.49]
Organism
hsa  Homo sapiens (human)
Pathway
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Hepatocellular carcinoma
Gastric cancer
Network
N00240  
TERT-overexpression to telomerase activity
Disease
H00018  
Gastric cancer
H00048  
Hepatocellular carcinoma
H00507  
Dyskeratosis congenita (DC)
H00764  
Chromosme 5p deletion syndrome
H01132  
Aplastic anemia (AA)
H01299  
Idiopathic pulmonary fibrosis
H01667  
Medulloblastoma
Drug target
Imetelstat: 
Imetelstat sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7015 (TERT)
   05225 Hepatocellular carcinoma
    7015 (TERT)
   05226 Gastric cancer
    7015 (TERT)
  Infectious diseases
   05166 HTLV-I infection
    7015 (TERT)
   05165 Human papillomavirus infection
    7015 (TERT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     7015 (TERT)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    7015 (TERT)
   Telomerase complex (fungi)
    7015 (TERT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14746(Tchem)
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5p15.33
AA seq 1132 aa AA seqDB search
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgctccccgctgccgagccgtgcgctccctgctgcgcagccactaccgcgag
gtgctgccgctggccacgttcgtgcggcgcctggggccccagggctggcggctggtgcag
cgcggggacccggcggctttccgcgcgctggtggcccagtgcctggtgtgcgtgccctgg
gacgcacggccgccccccgccgccccctccttccgccaggtgtcctgcctgaaggagctg
gtggcccgagtgctgcagaggctgtgcgagcgcggcgcgaagaacgtgctggccttcggc
ttcgcgctgctggacggggcccgcgggggcccccccgaggccttcaccaccagcgtgcgc
agctacctgcccaacacggtgaccgacgcactgcgggggagcggggcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctggttcacctgctggcacgctgcgcgctctttgtg
ctggtggctcccagctgcgcctaccaggtgtgcgggccgccgctgtaccagctcggcgct
gccactcaggcccggcccccgccacacgctagtggaccccgaaggcgtctgggatgcgaa
cgggcctggaaccatagcgtcagggaggccggggtccccctgggcctgccagccccgggt
gcgaggaggcgcgggggcagtgccagccgaagtctgccgttgcccaagaggcccaggcgt
ggcgctgcccctgagccggagcggacgcccgttgggcaggggtcctgggcccacccgggc
aggacgcgtggaccgagtgaccgtggtttctgtgtggtgtcacctgccagacccgccgaa
gaagccacctctttggagggtgcgctctctggcacgcgccactcccacccatccgtgggc
cgccagcaccacgcgggccccccatccacatcgcggccaccacgtccctgggacacgcct
tgtcccccggtgtacgccgagaccaagcacttcctctactcctcaggcgacaaggagcag
ctgcggccctccttcctactcagctctctgaggcccagcctgactggcgctcggaggctc
gtggagaccatctttctgggttccaggccctggatgccagggactccccgcaggttgccc
cgcctgccccagcgctactggcaaatgcggcccctgtttctggagctgcttgggaaccac
gcgcagtgcccctacggggtgctcctcaagacgcactgcccgctgcgagctgcggtcacc
ccagcagccggtgtctgtgcccgggagaagccccagggctctgtggcggcccccgaggag
gaggacacagacccccgtcgcctggtgcagctgctccgccagcacagcagcccctggcag
gtgtacggcttcgtgcgggcctgcctgcgccggctggtgcccccaggcctctggggctcc
aggcacaacgaacgccgcttcctcaggaacaccaagaagttcatctccctggggaagcat
gccaagctctcgctgcaggagctgacgtggaagatgagcgtgcgggactgcgcttggctg
cgcaggagcccaggggttggctgtgttccggccgcagagcaccgtctgcgtgaggagatc
ctggccaagttcctgcactggctgatgagtgtgtacgtcgtcgagctgctcaggtctttc
ttttatgtcacggagaccacgtttcaaaagaacaggctctttttctaccggaagagtgtc
tggagcaagttgcaaagcattggaatcagacagcacttgaagagggtgcagctgcgggag
ctgtcggaagcagaggtcaggcagcatcgggaagccaggcccgccctgctgacgtccaga
ctccgcttcatccccaagcctgacgggctgcggccgattgtgaacatggactacgtcgtg
ggagccagaacgttccgcagagaaaagagggccgagcgtctcacctcgagggtgaaggca
ctgttcagcgtgctcaactacgagcgggcgcggcgccccggcctcctgggcgcctctgtg
ctgggcctggacgatatccacagggcctggcgcaccttcgtgctgcgtgtgcgggcccag
gacccgccgcctgagctgtactttgtcaaggtggatgtgacgggcgcgtacgacaccatc
ccccaggacaggctcacggaggtcatcgccagcatcatcaaaccccagaacacgtactgc
gtgcgtcggtatgccgtggtccagaaggccgcccatgggcacgtccgcaaggccttcaag
agccacgtctctaccttgacagacctccagccgtacatgcgacagttcgtggctcacctg
caggagaccagcccgctgagggatgccgtcgtcatcgagcagagctcctccctgaatgag
gccagcagtggcctcttcgacgtcttcctacgcttcatgtgccaccacgccgtgcgcatc
aggggcaagtcctacgtccagtgccaggggatcccgcagggctccatcctctccacgctg
ctctgcagcctgtgctacggcgacatggagaacaagctgtttgcggggattcggcgggac
gggctgctcctgcgtttggtggatgatttcttgttggtgacacctcacctcacccacgcg
aaaaccttcctcaggaccctggtccgaggtgtccctgagtatggctgcgtggtgaacttg
cggaagacagtggtgaacttccctgtagaagacgaggccctgggtggcacggcttttgtt
cagatgccggcccacggcctattcccctggtgcggcctgctgctggatacccggaccctg
gaggtgcagagcgactactccagctatgcccggacctccatcagagccagtctcaccttc
aaccgcggcttcaaggctgggaggaacatgcgtcgcaaactctttggggtcttgcggctg
aagtgtcacagcctgtttctggatttgcaggtgaacagcctccagacggtgtgcaccaac
atctacaagatcctcctgctgcaggcgtacaggtttcacgcatgtgtgctgcagctccca
tttcatcagcaagtttggaagaaccccacatttttcctgcgcgtcatctctgacacggcc
tccctctgctactccatcctgaaagccaagaacgcagggatgtcgctgggggccaagggc
gccgccggccctctgccctccgaggccgtgcagtggctgtgccaccaagcattcctgctc
aagctgactcgacaccgtgtcacctacgtgccactcctggggtcactcaggacagcccag
acgcagctgagtcggaagctcccggggacgacgctgactgccctggaggccgcagccaac
ccggcactgccctcagacttcaagaccatcctggactga

DBGET integrated database retrieval system