KEGG   Homo sapiens (human): 7038Help
Entry
7038              CDS       T01001                                 

Gene name
TG, AITD3, TGN
Definition
thyroglobulin
Orthology
K10809  
thyroglobulin
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone synthesis
Autoimmune thyroid disease
Disease
H00251  
Thyroid dyshormonogenesis
Class
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
8q24
AA seq 2768 aa AA seqDB search
MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQT
VQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQC
QDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSP
PQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADS
QGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTK
CEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAE
GQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSG
LLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNV
GQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKK
DGTMNKPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVME
TVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPT
DCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAI
GKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWRQVQCNGPPEQ
VFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYP
SLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWC
VDEAGQELEGMRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVA
KGIRLRNEDLGLPPLFPPREAFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASA
LLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKS
RTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQASGAGTWCVDPASGEELRPGSS
SSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPG
TRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPG
PLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVF
ILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASL
PDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGC
SEGFYQVLTSEASQDGLGCVKCPEGSYSQDEECIPCPVGFYQEQAGSLACVPCPVGRTTI
SAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPL
EDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTEDEACSFFTVST
TEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKK
GQGSTTTLQKRFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVLT
QVQGGAIICGLLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIK
SLTPLEGTQDTFTNFQQVYLWKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVD
LNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTCT
LYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIRN
KVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSLGIQMCSEENG
GAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSS
VVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADT
QSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGT
SWKQVDQFLGVPYAAPPLAERRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSED
CLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVF
GFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTAR
ATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPAN
VLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRA
KAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRAL
ENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAY
EGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEF
SELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQE
PGSKTYSK
NT seq 8307 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtcctggagatcttcaccctgctggcctccatctgctgggtgtcggccaat
atcttcgagtaccaggtggatgcccagccccttcgtccctgtgagctgcagagggaaacg
gcctttctgaagcaagcagactacgtgccccagtgtgcagaggatggcagcttccagact
gtccagtgccagaacgacggccgctcctgctggtgtgtgggtgccaacggcagtgaagtg
ctgggcagcaggcagccaggacggcctgtggcttgtctgtcattttgtcagctacagaaa
cagcagatcttactgagtggctacattaacagcacagacacctcctacctccctcagtgt
caggattcaggggactacgcgcctgttcagtgtgatgtgcagcaggtccagtgctggtgt
gtggacgcagaggggatggaggtgtatgggacccgccagctggggaggccaaagcgatgt
ccaaggagctgtgaaataagaaatcgtcgtcttctccacggggtgggagataagtcacca
ccccagtgttctgcggagggagagtttatgcctgtccagtgcaaatttgtcaacaccaca
gacatgatgatttttgatctggtccacagctacaacaggtttccagatgcatttgtgacc
ttcagttccttccagaggaggttccctgaggtatctgggtattgccactgtgctgacagc
caagggcgggaactggctgagacaggtttggagttgttactggatgaaatttatgacacc
atttttgctggcctggaccttccttccaccttcactgaaaccaccctgtaccggatactg
cagagacggttcctcgcagttcaatcagtcatctctggcagattccgatgccccacaaaa
tgtgaagtggagcggtttacagcaaccagctttggtcacccctatgttccaagctgccgc
cgaaatggcgactatcaggcggtgcagtgccagacggaagggccctgctggtgtgtggac
gcccaggggaaggaaatgcatggaacccggcagcaaggggagccgccatcttgtgctgaa
ggccaatcttgtgcctccgaaaggcagcaggccttgtccagactctactttgggacctca
ggctacttcagccagcacgacctgttctcttccccagagaaaagatgggcctctccaaga
gtagccagatttgccacatcctgcccacccacgatcaaggagctctttgtggactctggg
cttctccgcccaatggtggagggacagagccaacagttttctgtctcagaaaatcttctc
aaagaagccatccgagcaatttttccctcccgagggctggctcgtcttgcccttcagttt
accaccaacccaaagagactccagcaaaacctttttggagggaaatttttggtgaatgtt
ggccagtttaacttgtctggagcccttggcacaagaggcacatttaacttcagtcaattt
ttccagcaacttggtcttgcaagcttcttgaatggagggagacaagaagatttggccaag
ccactctctgtgggattagattcaaattcttccacaggaacccctgaagctgctaagaag
gatggtactatgaataagccaactgtgggcagctttggctttgaaattaacctacaagag
aaccaaaatgccctcaaattccttgcttctctcctggagcttccagaattccttctcttc
ttgcaacatgctatctctgtgccagaagatgtggcaagagatttaggtgatgtgatggaa
acggtactcagctcccagacctgtgagcagacacctgaaaggctatttgtcccatcatgc
acgacagaaggaagctatgaggatgtccaatgcttttccggagagtgctggtgtgtgaat
tcctggggcaaagagcttccaggctcaagagtcagaggtggacagccaaggtgccccaca
gactgtgaaaagcaaagggctcgcatgcaaagcctcatgggcagccagcctgctggctcc
accttgtttgtccctgcttgtactagtgagggacatttcctgcctgtccagtgcttcaac
tcagagtgctactgtgttgatgctgagggtcaggccattcctggaactcgaagtgcaata
gggaagcccaagaaatgccccacgccctgtcaattacagtctgagcaagctttcctcagg
acggtgcaggccctgctctctaactccagcatgctacccaccctttccgacacctacatc
ccacagtgcagcaccgatgggcagtggagacaagtgcaatgcaatgggcctcctgagcag
gtcttcgagttgtaccaacgatgggaggctcagaacaagggccaggatctgacgcctgcc
aagctgctagtgaagatcatgagctacagagaagcagcttccggaaacttcagtctcttt
attcaaagtctgtatgaggctggccagcaagatgtcttcccggtgctgtcacaataccct
tctctgcaagatgtcccactagcagcactggaagggaaacggccccagcccagggagaat
atcctcctggagccctacctcttctggcagatcttaaatggccaactcagccaatacccg
gggtcctactcagacttcagcactcctttggcacattttgatcttcggaactgctggtgt
gtggatgaggctggccaagaactggaaggaatgcggtctgagccaagcaagctcccaaca
tgtcctggctcctgtgaggaagcaaagctccgtgtactgcagttcattagggaaacggaa
gagattgtttcagcttccaacagttctcggttccctctgggggagagtttcctggtggcc
aagggaatccggctgaggaatgaggacctcggccttcctccgctcttcccgccccgggag
gctttcgcggagcagtttctgcgtgggagtgattacgccattcgcctggcggctcagtct
accttaagcttctatcagagacgccgcttttccccggacgactcggctggagcatccgcc
cttctgcggtcgggcccctacatgccacagtgtgatgcgtttggaagttgggagcctgtg
cagtgccacgctgggactgggcactgctggtgtgtagatgagaaaggagggttcatccct
ggctcactgactgcccgctctctgcagattccacagtgcccgacaacctgcgagaaatct
cgaaccagtgggctgctttccagttggaaacaggctagatcccaagaaaacccatctcca
aaagacctgttcgtcccagcctgcctagaaacaggagagtatgccaggctgcaggcatcg
ggggctggcacctggtgtgtggaccctgcatcaggagaagagttgcggcctggctcgagc
agcagtgcccagtgcccaagcctctgcaatgtgctcaagagtggagtcctctccaggaga
gtcagcccaggctatgtcccagcctgcagggcagaggatgggggcttttccccagtgcaa
tgtgaccaggcccagggcagctgctggtgtgtcatggacagcggagaagaggtgcctggg
acgcgcgtgaccgggggccagcccgcctgtgagagcccgcggtgtccgctgccattcaac
gcgtcggaggtggttggtggaacaatcctgtgtgagacaatctcgggccccacaggctct
gccatgcagcagtgccaattgctgtgccgccagggctcctggagcgtgtttccaccaggg
ccattgatatgtagcctggagagcggacgctgggagtcacagctgcctcagccccgggcc
tgccaacggccccagctgtggcagaccatccagacccaagggcactttcagctccagctc
ccgccgggcaagatgtgcagtgctgactacgcggatttgctgcagactttccaggttttc
atattggatgagctgacagcccgcggcttctgccagatccaggtgaagacttttggcacc
ctggtttccattcctgtctgcaacaactcctctgtgcaggtgggttgtctgaccagggag
cgtttaggagtgaatgttacatggaaatcacggcttgaggacatcccagtggcttctctt
cctgacttacatgacattgagagagccttggtgggcaaggatctccttgggcgcttcaca
gatctgatccagagtggctcattccagcttcatctggactccaagacgttcccagcggaa
accatccgcttcctccaaggggaccactttggcacctctcccaggacatggtttgggtgc
tcggaaggattctaccaagtcttgacaagtgaggccagtcaggacggactgggatgcgtt
aagtgtcctgaaggaagctattcccaagatgaggaatgcattccttgtcctgttggattc
taccaagaacaggcagggagcttggcctgtgtcccatgtcctgtgggcagaacgaccatt
tctgctggagctttcagccagactcactgtgtcactgactgtcagaggaacgaagcaggc
ctgcaatgtgaccagaatggccagtatcgagccagccagaaggacaggggcagtgggaag
gccttctgtgtggacggcgaggggcggaggctgccatggtgggaaacagaggcccctctt
gaggactcacagtgtttgatgatgcagaagtttgagaaggttccagaatcaaaggtgatc
ttcgacgccaatgctcctgtggctgtcagatccaaagttcctgattctgagttccccgtg
atgcagtgcttgacagattgcacagaggacgaggcctgcagcttcttcaccgtgtccacg
acggagccagagatttcctgtgatttctatgcttggacaagtgacaatgttgcctgcatg
acttctgaccagaaacgagatgcactggggaactcaaaggccaccagctttggaagtctt
cgctgccaggtgaaagtgaggagccatggtcaagattctccagctgtgtatttgaaaaag
ggccaaggatccaccacaacacttcagaaacgctttgaacccactggtttccaaaacatg
ctttctggattgtacaaccccattgtgttctcagcctcaggagccaatctaaccgatgct
cacctcttctgtcttcttgcatgcgaccgtgatctgtgttgcgatggcttcgtcctcaca
caggttcaaggaggtgccatcatctgtgggttgctgagctcacccagtgtcctgctttgt
aatgtcaaagactggatggatccctctgaagcctgggctaatgctacatgtcctggtgtg
acatatgaccaggagagccaccaggtgatattgcgtcttggagaccaggagttcatcaag
agtctgacacccttagaaggaactcaagacacctttaccaattttcagcaggtttatctc
tggaaagattctgacatggggtctcggcctgagtctatgggatgtagaaaagacacagtg
ccaaggccagcatctccaacagaagcaggtttgacaacagaacttttctcccctgtggac
ctcaaccaggtcattgtcaatggaaatcaatcactatccagccagaagcactggcttttc
aagcacctgttttcagcccagcaggcaaacctatggtgcctttctcgttgtgtgcaggag
cactctttctgtcagctcgcagagataacagagagtgcatccttgtacttcacctgcacc
ctctacccagaggcacaggtgtgtgatgacatcatggagtccaatgcccagggctgcaga
ctgatcctgcctcagatgccaaaggccctgttccggaagaaagttatactggaagataaa
gtgaagaacttttacactcgcctgccgttccaaaaactgatggggatatccattagaaat
aaagtgcccatgtctgaaaaatctatttctaatgggttctttgaatgtgaacgacggtgc
gatgcggacccatgctgcactggctttggatttctaaatgtttcccagttaaaaggagga
gaggtgacatgtctcactctgaacagcttgggaattcagatgtgcagtgaggagaatgga
ggagcctggcgcattttggactgtggctctcctgacattgaagtccacacctatcccttc
ggatggtaccagaagcccattgctcaaaataatgctcccagtttttgccctttggttgtt
ctgccttccctcacagagaaagtgtctctggactcgtggcagtccctggccctctcttca
gtggttgttgatccatccattaggcactttgatgttgcccatgtcagcactgctgccacc
agcaatttctctgctgtccgagacctctgtttgtcggaatgttcccaacatgaggcctgt
ctcatcaccactctgcaaacccaacctggggctgtgagatgtatgttctatgctgatact
caaagctgcacacatagtctgcagggtcagaactgccgacttctgcttcgtgaagaggcc
acccacatctaccggaagccaggaatctctctgctcagctatgaggcatctgtaccttct
gtgcccatttccacccatggccggctgctgggcaggtcccaggccatccaggtgggtacc
tcatggaagcaagtggaccagttccttggagttccatatgctgccccgcccctggcagag
aggcgcttccaggcaccagagcccttgaactggacaggctcctgggatgccagcaagcca
agggccagctgctggcagccaggcaccagaacatccacgtctcctggagtcagtgaagat
tgtttgtatctcaatgtgttcatccctcagaatgtggcccctaacgcgtctgtgctggtg
ttcttccacaacaccatggacagggaggagagtgaaggatggccggctatcgacggctcc
ttcttggctgctgttggcaacctcatcgtggtcactgccagctaccgagtgggtgtcttc
ggcttcctgagttctgggtccggagaggtgagtggcaactgggggctgctggaccaggtg
gcggctctgacctgggtgcagacccacatccgaggatttggcggggaccctcggcgcgtg
tccctggcagcagaccgtggcggggctgatgtggccagcatccaccttctcacggccagg
gccaccaactcccaacttttccggagagctgtgctgatgggaggctccgcactctccccg
gccgccgtcatcagccatgagagggctcagcagcaggcaattgctttggcaaaggaggtc
agttgccccatgtcatccagccaagaagtggtgtcctgcctccgccagaagcctgccaat
gtcctcaatgatgcccagaccaagctcctggccgtgagtggccctttccactactggggt
cctgtgatcgatggccacttcctccgtgagcctccagccagagcactgaagaggtcttta
tgggtagaggtcgatctgctcattgggagttctcaggacgacgggctcatcaacagagca
aaggctgtgaagcaatttgaggaaagtcgaggccggaccagtagcaaaacagccttttac
caggcactgcagaattctctgggtggcgaggactcagatgcccgcgtcgaggctgctgct
acatggtattactctctggagcactccacggatgactatgcctccttctcccgggctctg
gagaatgccacccgggactactttatcatctgccctataatcgacatggccagtgcctgg
gcaaagagggcccgaggaaacgtcttcatgtaccatgctcctgaaaactacggccatggc
agcctggagctgctggcggatgttcagtttgccttggggcttcccttctacccagcctac
gaggggcagttttctctggaggagaagagcctgtcgctgaaaatcatgcagtacttttcc
cacttcatcagatcaggaaatcccaactacccttatgagttctcacggaaagtacccaca
tttgcaaccccctggcctgactttgtaccccgtgctggtggagagaactacaaggagttc
agtgagctgctccccaatcgacagggcctgaagaaagccgactgctccttctggtccaag
tacatctcgtctctgaagacatctgcagatggagccaagggcgggcagtcagcagagagt
gaagaggaggagttgacggctggatctgggctaagagaagatctcctaagcctccaggaa
ccaggctctaagacctacagcaagtga

DBGET integrated database retrieval system