KEGG   Homo sapiens (human): 7066Help
Entry
7066              CDS       T01001                                 

Gene name
THPO, MGDF, MKCSF, ML, MPLLG, THCYT1, TPO
Definition
thrombopoietin
Orthology
K06854  
thrombopoietin
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    7066 (THPO)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7066 (THPO)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7066 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3q27
AA seq 353 aa AA seqDB search
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPV
LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL
LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTT
AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSL
DQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatgcttctcctaactgcaaggctaacgctg
tccagcccggctcctcctgcttgtgacctccgagtcctcagtaaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgcccagaggttcaccctttgcctacacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggagaccaag
gcacaggacattctgggagcagtgacccttctgctggagggagtgatggcagcacgggga
caactgggacccacttgcctctcatccctcctggggcagctttctggacaggtccgtctc
ctccttggggccctgcagagcctccttggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgatgcttgtaggagggtccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcagccagaactactggctctgggcttctgaag
tggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccccggatacctgaacaggatacacgaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagccccggacatttcctcaggaacatcagac
acaggctccctgccacccaacctccagcctggatattctccttccccaacccatcctcct
actggacagtatacgctcttccctcttccacccaccttgcccacccctgtggtccagctc
caccccctgcttcctgacccttctgctccaacgcccacccctaccagccctcttctaaac
acatcctacacccactcccagaatctgtctcaggaagggtaa

DBGET integrated database retrieval system