KEGG   Homo sapiens (human): 7096Help
Entry
7096              CDS       T01001                                 

Gene name
TLR1, CD281, TIL, TIL._LPRS5, rsc786
Definition
toll-like receptor 1
Orthology
K05398  
toll-like receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Tuberculosis
Disease
H00344  
Leprosy
Class
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4p14
AA seq 786 aa AA seqDB search
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID
QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL
CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL
TEQAKK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatcttccattttgccattatcttcatgttaatacttcagatcagaatacaa
ttatctgaagaaagtgaatttttagttgataggtcaaaaaacggtctcatccacgttcct
aaagacctatcccagaaaacaacaatcttaaatatatcgcaaaattatatatctgagctt
tggacttctgacatcttatcactgtcaaaactgaggattttgataatttctcataataga
atccagtatcttgatatcagtgttttcaaattcaaccaggaattggaatacttggatttg
tcccacaacaagttggtgaagatttcttgccaccctactgtgaacctcaagcacttggac
ctgtcatttaatgcatttgatgccctgcctatatgcaaagagtttggcaatatgtctcaa
ctaaaatttctggggttgagcaccacacacttagaaaaatctagtgtgctgccaattgct
catttgaatatcagcaaggtcttgctggtcttaggagagacttatggggaaaaagaagac
cctgagggccttcaagactttaacactgagagtctgcacattgtgttccccacaaacaaa
gaattccattttattttggatgtgtcagtcaagactgtagcaaatctggaactatctaat
atcaaatgtgtgctagaagataacaaatgttcttacttcctaagtattctggcgaaactt
caaacaaatccaaagttatcaaatcttaccttaaacaacattgaaacaacttggaattct
ttcattaggatcctccagctggtttggcatacaactgtatggtatttctcaatttcaaac
gtgaagctacagggtcagctggacttcagagattttgattattctggcacttccttgaag
gccttgtctatacaccaagttgtcagcgatgtgttcggttttccgcaaagttatatctat
gaaatcttttcgaatatgaacatcaaaaatttcacagtgtctggtacacgcatggtccac
atgctttgcccatccaaaattagcccgttcctgcatttggatttttccaataatctctta
acagacacggtttttgaaaattgtgggcaccttactgagttggagacacttattttacaa
atgaatcaattaaaagaactttcaaaaatagctgaaatgactacacagatgaagtctctg
caacaattggatattagccagaattctgtaagctatgatgaaaagaaaggagactgttct
tggactaaaagtttattaagtttaaatatgtcttcaaatatacttactgacactattttc
agatgtttacctcccaggatcaaggtacttgatcttcacagcaataaaataaagagcatt
cctaaacaagtcgtaaaactggaagctttgcaagaactcaatgttgctttcaattcttta
actgaccttcctggatgtggcagctttagcagcctttctgtattgatcattgatcacaat
tcagtttcccacccatcggctgatttcttccagagctgccagaagatgaggtcaataaaa
gcaggggacaatccattccaatgtacctgtgagctaggagaatttgtcaaaaatatagac
caagtatcaagtgaagtgttagagggctggcctgattcttataagtgtgactacccggaa
agttatagaggaaccctactaaaggactttcacatgtctgaattatcctgcaacataact
ctgctgatcgtcaccatcgttgccaccatgctggtgttggctgtgactgtgacctccctc
tgcagctacttggatctgccctggtatctcaggatggtgtgccagtggacccagacccgg
cgcagggccaggaacatacccttagaagaactccaaagaaatctccagtttcatgcattt
atttcatatagtgggcacgattctttctgggtgaagaatgaattattgccaaacctagag
aaagaaggtatgcagatttgccttcatgagagaaactttgttcctggcaagagcattgtg
gaaaatatcatcacctgcattgagaagagttacaagtccatctttgttttgtctcccaac
tttgtccagagtgaatggtgccattatgaactctactttgcccatcacaatctctttcat
gaaggatctaatagcttaatcctgatcttgctggaacccattccgcagtactccattcct
agcagttatcacaagctcaaaagtctcatggccaggaggacttatttggaatggcccaag
gaaaagagcaaacgtggccttttttgggctaacttaagggcagccattaatattaagctg
acagagcaagcaaagaaatag

DBGET integrated database retrieval system