KEGG   Homo sapiens (human): 7414Help
Entry
7414              CDS       T01001                                 

Gene name
VCL, CMD1W, CMH15, HEL114, MV, MVCL
Definition
vinculin
Orthology
K05700  
vinculin
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Adherens junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Amoebiasis
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    7414 (VCL)
  Cell communication
   04510 Focal adhesion
    7414 (VCL)
   04520 Adherens junction
    7414 (VCL)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7414 (VCL)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    7414 (VCL)
   05100 Bacterial invasion of epithelial cells
    7414 (VCL)
   05146 Amoebiasis
    7414 (VCL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7414 (VCL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q22.2
AA seq 1066 aa AA seqDB search
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDE
VTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT
EMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgtttcatacgcgcacgatcgagagcatcctggagccggtggcacagcagatc
tcccacctggtgataatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
accgcgcccgtggccgccgtgcaggcggccgtcagcaacctcgtccgggttggaaaagag
actgttcaaaccactgaggatcagattttgaagagagatatgccaccagcatttattaag
gttgagaatgcttgcaccaagcttgtccaggcagctcagatgcttcagtcagacccttac
tcagtgcctgctcgagattatctaattgatgggtcaaggggcatcctctctggaacatca
gacctgctccttaccttcgatgaggctgaggtccgtaaaattattagagtttgcaaagga
attttggaatatcttacagtggcagaggtggtggagactatggaagatttggtcacttac
acaaagaatcttgggccaggaatgactaagatggccaagatgattgacgagagacagcag
gagctcactcaccaggagcaccgagtgatgttggtgaactcgatgaacaccgtgaaagag
ttgctgccagttctcatttcagctatgaagatttttgtaacaactaaaaactcaaaaaac
caaggcatagaggaagctttaaaaaatcgcaattttactgtagaaaaaatgagtgctgaa
attaatgagataattcgtgtgttacaactcacctcttgggatgaagatgcctgggccagc
aaggacactgaagccatgaagagagcattggcctccatagactccaaactgaaccaggcc
aaaggttggctccgtgaccctagtgcctccccaggggatgctggtgagcaggccatcaga
cagatcttagatgaagctggaaaagttggtgaactctgtgcaggcaaagaacgcagggag
attctgggaacttgcaaaatgctagggcagatgactgatcaagtggctgacctccgtgcc
agaggacaaggatcctcaccggtggccatgcagaaagctcagcaggtatctcagggtctg
gatgtgctcacagcaaaagtggaaaatgcagctcgcaagctggaagccatgaccaactca
aagcagagcattgcaaagaagatcgatgctgctcagaactggcttgcagatccaaatggt
ggaccggaaggagaagagcagattcgaggtgctttggctgaagctcggaaaatagcagaa
ttatgtgatgatcctaaagaaagagatgacattctacgttcccttggggaaatatctgct
ctgacttctaaattagcagatctacgaagacaggggaaaggagattctccagaggctcga
gccttggccaaacaggtggccacggccctgcagaacctgcagaccaaaaccaaccgggct
gtggccaacagcagaccggccaaagcagctgtacaccttgagggcaagattgagcaagca
cagcggtggattgataatcccacagtggatgaccgtggagtcggtcaggctgccatccgg
gggcttgtggccgaagggcatcgtctggctaatgttatgatggggccttatcggcaagat
cttctcgccaagtgtgaccgagtggaccagctgacagcccagctggctgacctggctgcc
agaggggaaggggagagtcctcaggcacgagcacttgcatctcagctccaagactcctta
aaggatctaaaagctcggatgcaggaggccatgactcaggaagtgtcagatgttttcagc
gataccacaactcccatcaagctgttggcagtggcagccacggcgcctcctgatgcgcct
aacagggaagaggtatttgatgagagggcagctaactttgaaaaccattcaggaaagctt
ggtgctacggccgagaaggcggctgcggttggtactgctaataaatcaacagtggaaggc
attcaggcctcagtgaagacggcccgagaactcacaccccaggtggtctcggctgctcgt
atcttacttaggaaccctggaaatcaagctgcttatgaacattttgagaccatgaagaac
cagtggatcgataatgttgaaaaaatgacagggctggtggacgaagccattgataccaaa
tctctgttggatgcttcagaagaagcaattaaaaaagacctggacaagtgcaaggtagct
atggccaacattcagcctcagatgctggttgctggggcaaccagtattgctcgtcgggcc
aaccggatcctgctggtggctaagagggaggtggagaattccgaggatcccaagttccgt
gaggctgtgaaagctgcctctgatgaattgagcaaaaccatctccccgatggtgatggat
gcaaaagctgtggctggaaacatttccgaccctggactgcaaaagagcttcctggactca
ggatatcggatcctgggagctgtggccaaggtcagagaagccttccaacctcaggagcct
gacttcccgccgcctccaccagaccttgaacaactccgactaacagatgagcttgctcct
cccaaaccacctctgcctgaaggtgaggtccctccacctaggcctccaccaccagaggaa
aaggatgaagagttccctgagcagaaggccggggaggtgattaaccagccaatgatgatg
gctgccagacagctccatgatgaagctcgcaaatggtccagcaagggcaatgacatcatt
gcagcagccaagcgcatggctctgctgatggctgagatgtctcggctggtaagagggggc
agtggtaccaagcgggcactcattcagtgtgccaaggacatcgccaaggcctcagatgag
gtgactcggttggccaaggaggttgccaagcagtgcacagataaacggattagaaccaac
ctcttacaggtatgtgagcgaatcccaaccataagcacccagctcaaaatcctgtccaca
gtgaaggccaccatgctgggccggaccaacatcagtgatgaggagtctgagcaggccaca
gagatgctggttcacaatgcccagaacctcatgcagtctgtgaaggagactgtgcgggaa
gctgaagctgcttcaatcaaaattcgaacagatgctggatttacactgcgctgggttaga
aagactccctggtaccagtag

DBGET integrated database retrieval system