KEGG   Homo sapiens (human): 7466Help
Entry
7466              CDS       T01001                                 

Gene name
WFS1, CTRCT41, WFRS, WFS, WFSL, DFNA6, DFNA14, DFNA38
Definition
Wolfram syndrome 1 (wolframin)
Orthology
K14020  
wolfamin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Disease
H00409  
Type II diabetes mellitus
H00604  
Deafness, autosomal dominant
H00854  
Wolfram syndrome (WFS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7466 (WFS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
4p16.1
AA seq 890 aa AA seqDB search
MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAP
AEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEE
LNSCTAVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERAVRKAA
LVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQKQRRMLERLVSSESKN
YIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPEDLPLRLKVVKYPLHAIMEIK
EYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIFYLSFISMVIC
TLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFP
IASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPY
LKVLGQTFITVPVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMW
CELSVVILLESTGLGLLRASIGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVT
VAVCSVPLLLRWWTKASFSVVGMVKSLTRSSMVKLILVWLTAIVLFCWFYVYRSEGMKVY
NSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTDIDNSAESAI
NMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKFDRYKFEITVG
MPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVF
ELKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggactccaacactgctccgctgggcccctcctgcccacagcccccgccagcaccgcag
ccccaggcgcgttcccgactcaatgccacagcctcgttggagcaggagaggagcgaaagg
ccccgagcacccggaccccaggctggccctggccctggtgttagagacgcagcggccccc
gctgaaccccaggcccagcataccaggagccgggaaagagcagacggcaccgggcctaca
aagggagacatggaaatcccctttgaagaagtcctggagagggccaaggccggggacccc
aaggcacagactgaggtggggaagcactacctgcagttggccggcgacacggatgaagaa
ctcaacagctgcaccgctgtggactggctggtcctcgccgcgaagcagggccgtcgcgag
gctgtgaagctgcttcgccggtgcttggcggacagaagaggcatcacgtccgagaacgaa
cgggaggtgaggcagctctcctccgagaccgacctggagagggccgtgcgcaaggcagcc
ctggtcatgtactggaagctcaaccccaagaagaagaagcaggtggccgtggcggagctg
ctggagaatgtcggccaggtcaacgagcacgatggaggggcgcagccaggccccgtgccc
aagtccctgcagaagcagaggcgcatgctggagcgcctggtcagcagcgagtccaagaac
tacatcgcgctggatgactttgtggagatcactaagaagtacgccaagggcgtcatcccc
agcagcctgttcctgcaggacgacgaagatgatgacgagctggcggggaagagccctgag
gacctgccactgcgtctgaaggtggtcaagtaccccctgcacgccatcatggagatcaag
gagtacctgattgacatggcctccagggcaggcatgcactggctgtccaccatcatcccc
acgcaccacatcaacgcgctcatcttcttcttcatcgtcagcaacctcaccatcgacttc
ttcgccttcttcatcccgctggtcatcttctacctgtccttcatctccatggtgatctgc
accctcaaggtgttccaggacagcaaggcctgggagaacttccgcaccctcaccgacctg
ctgctgcgcttcgagcccaacctggatgtggagcaggccgaggtcaacttcggctggaac
cacctggagccctatgcccatttcctgctctctgtcttcttcgtcatcttctccttcccc
atcgccagcaaggactgcatcccctgctcggagctggctgtcatcaccggcttctttacc
gtgaccagctacctgagcctgagcacccatgcagagccctacacgcgcagggccctggcc
accgaggtcaccgccggcctgctatcgctgctgccctccatgcccttgaattggccctac
ctgaaggtccttggccagaccttcatcaccgtgcctgtcggccacctggtcgtcctcaac
gtcagcgtcccgtgcctgctctatgtctacctgctctatctcttcttccgcatggcacag
ctgaggaatttcaagggcacctactgctaccttgtgccctacctggtgtgcttcatgtgg
tgtgagctctccgtggtcatcctgctggagtccaccggcctggggctgctccgcgcctcc
atcggctacttcctcttcctctttgccctccccatcctggtggccggcctggccctggtg
ggcgtgctgcagttcgcccggtggttcacgtctctggagctcaccaagatcgcagtcacc
gtggcggtctgtagtgtgcccctgctgttgcgctggtggaccaaggccagcttctctgtg
gtggggatggtgaagtccctgacgcggagctccatggtcaagctcatcctggtgtggctc
acggccatcgtgctgttctgctggttctatgtgtaccgctcagagggcatgaaggtctac
aactccacactgacctggcagcagtatggtgcgctgtgcgggccacgcgcctggaaggag
accaacatggcgcgcacccagatcctctgcagccacctggagggccacagggtcacgtgg
accggccgcttcaagtacgtccgcgtgactgacatcgacaacagcgccgagtctgccatc
aacatgctcccgttcttcatcggcgactggatgcgctgcctctacggcgaggcctaccct
gcctgcagccctggcaacacctccacggccgaggaggagctctgtcgccttaagctgctg
gccaagcacccctgccacatcaagaagttcgaccgctacaagtttgagattaccgtgggc
atgccattcagcagcggcgctgacggctcgcgcagccgcgaggaggacgacgtcaccaag
gacatcgtgctgcgggccagcagcgagttcaagagcgtgctgctcagcctgcgccagggc
agcctcatcgagttcagcaccatcctggagggccgcctgggcagcaagtggcctgtcttc
gagctcaaggccatcagctgcctcaactgcatggcccagctctcacccaccaggcggcac
gtgaagatcgagcacgactggcgcagcaccgtgcatggcgccgtgaagttcgccttcgac
ttctttttcttcccattcctgtcggcggcctga

DBGET integrated database retrieval system