KEGG   Homo sapiens (human): 7507Help
Entry
7507              CDS       T01001                                 

Gene name
XPA, XP1, XPAC
Definition
xeroderma pigmentosum, complementation group A
Orthology
K10847  
DNA-repair protein complementing XP-A cells
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Disease
H00403  
Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    7507 (XPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q22.3
AA seq 273 aa AA seqDB search
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgacggggctttgccggaggcggcggctttagagcaacccgcggagctg
cctgcctcggtgcgggcgagtatcgagcggaagcggcagcgggcactgatgctgcgccag
gcccggctggctgcccggccctactcggcgacggcggctgcggctactggaggcatggct
aatgtaaaagcagccccaaagataattgacacaggaggaggcttcattttagaagaggaa
gaagaagaagaacagaaaattggaaaagttgttcatcaaccaggacctgttatggaattt
gattatgtaatatgcgaagaatgtgggaaagaatttatggattcttatcttatgaaccac
tttgatttgccaacttgtgataactgcagagatgctgatgataaacacaagcttataacc
aaaacagaggcaaaacaagaatatcttctgaaagactgtgatttagaaaaaagagagcca
cctcttaaatttattgtgaagaagaatccacatcattcacaatggggtgatatgaaactc
tacttaaagttacagattgtgaagaggtctcttgaagtttggggtagtcaagaagcatta
gaagaagcaaaggaagtccgacaggaaaaccgagaaaaaatgaaacagaagaaatttgat
aaaaaagtaaaagaattgcggcgagcagtaagaagcagcgtgtggaaaagggagacgatt
gttcatcaacatgagtatggaccagaagaaaacctagaagatgacatgtaccgtaagact
tgtactatgtgtggccatgaactgacatatgaaaaaatgtga

DBGET integrated database retrieval system