KEGG   Homo sapiens (human): 7704Help
Entry
7704              CDS       T01001                                 

Gene name
ZBTB16, PLZF, ZNF145
Definition
zinc finger and BTB domain containing 16
Orthology
K10055  
zinc finger and BTB domain-containing protein 16
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
H00969  
Skeletal defects, genital hypoplasia, and mental retardation
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q23.1
AA seq 673 aa AA seqDB search
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggatctgacaaaaatgggcatgatccagctgcagaaccctagccaccccacggggcta
ctgtgcaaggccaaccagatgcggctggccgggactttgtgcgatgtggtcatcatggtg
gacagccaggagttccacgcccaccggacggtgctggcctgcaccagcaagatgtttgag
atcctcttccaccgcaatagtcaacactatactttggacttcctctcgccaaagaccttc
cagcagattctggagtatgcatatacagccacgctgcaagccaaggcggaggacctggat
gacctgctgtatgcggccgagatcctggagatcgagtacctggaggaacagtgcctgaag
atgctggagaccatccaggcctcagacgacaatgacacggaggccaccatggccgatggc
ggggccgaggaagaagaggaccgcaaggctcggtacctcaagaacatcttcatctcgaag
cattccagcgaggagagtgggtatgccagtgtggctggacagagcctccctgggcccatg
gtggaccagagcccttcagtctccacttcatttggtctttcagccatgagtcccaccaag
gctgcagtggacagtttgatgaccataggacagtctctcctgcagggaactcttcagcca
cctgcagggcccgaggagccaactctggctgggggtgggcggcaccctggggtggctgag
gtgaagacggagatgatgcaggtggatgaggtgcccagccaggacagccctggggcagcc
gagtccagcatctcaggagggatgggggacaaggttgaggaaagaggcaaagaggggcct
gggaccccgactcgaagcagcgtcatcaccagtgctagggagctacactatgggcgagag
gagagtgccgagcaggtgccacccccagctgaggctggccaggcccccactggccgacct
gagcacccagcacccccgcctgagaagcatctgggcatctactccgtgttgcccaaccac
aaggctgacgctgtattgagcatgccgtcttccgtgacctctggcctccacgtgcagcct
gccctggctgtctccatggacttcagcacctatggggggctgctgccccagggcttcatc
cagagggagctgttcagcaagctgggggagctggctgtgggcatgaagtcagagagccgg
accatcggagagcagtgcagcgtgtgtggggtcgagcttcctgataacgaggctgtggag
cagcacaggaagctgcacagtgggatgaagacgtacgggtgcgagctctgcgggaagcgg
ttcctggatagtttgcggctgagaatgcacttactggctcattcagcgggtgccaaagcc
tttgtctgtgatcagtgcggtgcacagttttcgaaggaggatgccctggagacacacagg
cagacccatactggcactgacatggccgtcttctgtctgctgtgtgggaagcgcttccag
gcgcagagcgcactgcagcagcacatggaggtccacgcgggcgtgcgcagctacatctgc
agtgagtgcaaccgcaccttccccagccacacggctctcaaacgccacctgcgctcacat
acaggcgaccacccctacgagtgtgagttctgtggcagctgcttccgggatgagagcaca
ctcaagagccacaaacgcatccacacgggtgagaaaccctacgagtgcaatggctgtggc
aagaagttcagcctcaagcatcagctggagacgcactatagggtgcacacaggtgagaag
ccctttgagtgtaagctctgccaccagcgctcccgggactactcggccatgatcaagcac
ctgagaacgcacaacggcgcctcgccctaccagtgcaccatctgcacagagtactgcccc
agcctctcctccatgcagaagcacatgaagggccacaagcccgaggagatcccgcccgac
tggaggatagagaagacgtacctctacctgtgctatgtgtga

DBGET integrated database retrieval system