KEGG   Homo sapiens (human): 7846Help
Entry
7846              CDS       T01001                                 

Gene name
TUBA1A, B-ALPHA-1, LIS3, TUBA3
Definition
(RefSeq) tubulin alpha 1a
  KO
K07374  tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04210  Apoptosis
hsa04530  Tight junction
hsa04540  Gap junction
hsa05130  Pathogenic Escherichia coli infection
Disease
H00268  Lissencephaly (LIS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7846 (TUBA1A)
  Cell growth and death
   04210 Apoptosis
    7846 (TUBA1A)
  Cellular community - eukaryotes
   04530 Tight junction
    7846 (TUBA1A)
   04540 Gap junction
    7846 (TUBA1A)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7846 (TUBA1A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     7846 (TUBA1A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     7846 (TUBA1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    7846 (TUBA1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7846 (TUBA1A)
  Exosomal proteins of other body fluids (saliva and urine)
   7846 (TUBA1A)
  Exosomal proteins of colorectal cancer cells
   7846 (TUBA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 7846
NCBI-ProteinID: NP_001257328
OMIM: 602529
HGNC: 20766
Ensembl: ENSG00000167552
Vega: OTTHUMG00000169511
Pharos: Q71U36(Tchem)
UniProt: Q71U36
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12q13.12
AA seq 451 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgttggccaggctggtgtccagattggcaatgcctgc
tgggagctctactgcctggaacacggcatccagcccgatggccagatgccaagtgacaag
accattgggggaggagatgattccttcaacaccttcttcagtgagacgggggctggcaag
catgtgccccgggcagtgtttgtagacttggaacccacagtcattgatgaagttcgcact
ggcacctaccgccagctcttccaccctgagcaacttatcacaggcaaagaagatgctgcc
aataactatgcccgagggcactacaccattggcaaggagatcattgacctcgtgttggac
cgaattcgcaagctggccgaccagtgcacgggtctccagggcttcttggttttccacagc
tttggtgggggaactggttctgggttcacctcgctgctcatggaacgtctctcagttgat
tatggcaagaagtccaagctggagttctctatttacccggcgccccaggtttccacagct
gtagttgagccctacaactccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgacatctgtcgtagaaacctcgatattgag
cgtccaacctatactaacctgaataggttaataggtcaaattgtgtcctccatcactgct
tccctgagatttgatggagccctgaatgttgacctgacagaattccagaccaacctggtg
ccctatccccgcatccacttccctctggccacatatgcccctgtcatctctgctgagaaa
gcctaccatgaacagctttctgtagcagagatcaccaatgcttgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgttgtaccgt
ggtgacgtggttcccaaagatgtcaatgctgccattgccaccatcaagaccaagcgtacc
atccagtttgtggattggtgccccactggcttcaaggttggcatcaactaccagcctccc
actgtggtgcctggtggagacctggccaaggtacagagagctgtgtgcatgctgagcaac
accacagccattgctgaggcctgggctcgcctggaccacaagtttgacctgatgtatgcc
aaacgtgcctttgttcactggtacgttggggaggggatggaggaaggtgagttttcagag
gcccgtgaggacatggctgcccttgagaaggattatgaggaggttggtgtggattctgtt
gaaggagagggtgaggaagaaggagaggaatactaa

DBGET integrated database retrieval system