KEGG   Homo sapiens (human): 7879Help
Entry
7879              CDS       T01001                                 

Gene name
RAB7A, PRO2706, RAB7
Definition
RAB7A, member RAS oncogene family
Orthology
K07897  
Ras-related protein Rab-7A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Phagosome
Salmonella infection
Amoebiasis
Tuberculosis
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 207 aa AA seqDB search
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg
aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca
ataggagctgactttctgaccaaggaggtgatggtggatgacaggctagtcacaatgcag
atatgggacacagcaggacaggaacggttccagtctctcggtgtggccttctacagaggt
gcagactgctgcgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat
agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttcccattt
gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag
gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc
aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg
gagctgtacaacgaatttcctgaacctatcaaactggacaagaatgaccgggccaaggcc
tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system