KEGG   Homo sapiens (human): 7879Help
Entry
7879              CDS       T01001                                 

Gene name
RAB7A, PRO2706, RAB7
Definition
RAB7A, member RAS oncogene family
Orthology
K07897  
Ras-related protein Rab-7A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Phagosome
Salmonella infection
Amoebiasis
Tuberculosis
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7879 (RAB7A)
   04145 Phagosome
    7879 (RAB7A)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    7879 (RAB7A)
   05152 Tuberculosis
    7879 (RAB7A)
   05146 Amoebiasis
    7879 (RAB7A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7879 (RAB7A)
  Exosomal proteins of other body fluids (saliva and urine)
   7879 (RAB7A)
  Exosomal proteins of colorectal cancer cells
   7879 (RAB7A)
  Exosomal proteins of bladder cancer cells
   7879 (RAB7A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    7879 (RAB7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 207 aa AA seqDB search
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg
aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca
ataggagctgactttctgaccaaggaggtgatggtggatgacaggctagtcacaatgcag
atatgggacacagcaggacaggaacggttccagtctctcggtgtggccttctacagaggt
gcagactgctgcgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat
agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttcccattt
gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag
gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc
aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg
gagctgtacaacgaatttcctgaacctatcaaactggacaagaatgaccgggccaaggcc
tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system