KEGG   Homo sapiens (human): 79644Help
Entry
79644             CDS       T01001                                 

Gene name
SRD5A3, CDG1P, CDG1Q, KRIZI, SRD5A2L, SRD5A2L1
Definition
steroid 5 alpha-reductase 3 (EC:1.3.1.22 1.3.1.94)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Drug target
Finasteride: 
Other: 
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
4q12
AA seq 318 aa AA seqDB search
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP
SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF
QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ
VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK
SKFVSYPKHRKAFLPFLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctccctgggcggaggccgagcactcggcgctgaacccgctgcgcgcggtgtggctc
acgctgaccgccgccttcctgctgaccctactgctgcagctcctgccgcccggcctgctc
ccgggctgcgcgatcttccaggacctgatccgctatgggaaaaccaagtgtggggagccg
tcgcgccccgccgcctgccgagcctttgatgtccccaagagatatttttcccacttttat
atcatctcagtgctgtggaatggcttcctgctttggtgccttactcaatctctgttcctg
ggagcaccttttccaagctggcttcatggtttgctcagaattctcggggcggcacagttc
cagggaggggagctggcactgtctgcattcttagtgctagtatttctgtggctgcacagc
ttacgaagactcttcgagtgcctctacgtcagtgtcttctccaatgtcatgattcacgtc
gtgcagtactgttttggacttgtctattatgtccttgttggcctaactgtgctgagccaa
gtgccaatggatggcaggaatgcctacataacagggaaaaatctattgatgcaagcacgg
tggttccatattcttgggatgatgatgttcatctggtcatctgcccatcagtataagtgc
catgttattctcggcaatctcaggaaaaataaagcaggagtggtcattcactgtaaccac
aggatcccatttggagactggtttgaatatgtttcttcccctaactacttagcagagctg
atgatctacgtttccatggccgtcacctttgggttccacaacttaacttggtggctagtg
gtgacaaatgtcttctttaatcaggccctgtctgcctttctcagccaccaattctacaaa
agcaaatttgtctcttacccgaagcataggaaagctttcctaccatttttgttttaa

DBGET integrated database retrieval system