KEGG   Homo sapiens (human): 8029Help
Entry
8029              CDS       T01001                                 

Gene name
CUBN, IFCR, MGA1, gp280
Definition
cubilin (intrinsic factor-cobalamin receptor)
Orthology
K14616  
cubilin
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H01277  
Vitamin B12 deficiency anaemia
Class
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10p12.31
AA seq 3623 aa AA seqDB search
MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKEDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGE
PKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKC
DSGWTGVNCTENINECLSNPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPECGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRQMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEY
HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN
ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ
DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC
GGHILTSSFDTVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV
EILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGG
TFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE
GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH
GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA
RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG
FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR
DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR
GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD
ICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN
VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL
ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRV
PGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDN
HTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSI
GTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNS
PQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSLPNTPEG
NFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQDCQFDVLEFRVGDA
DGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVI
TSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPII
GQYCGNSNPRTIQSGSNQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSDNGTIRSPH
WPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLA
TGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQY
DNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCG
DEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSGIITSPAYSYADYPN
DMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPN
VKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGMYD
KNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGST
VPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISSPNSSDPD
VPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASA
VPVFYSSMSTAMVIFKSGVVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKD
CTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFS
QNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWV
LVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSN
QVFIKFHADYARRPSAFRLTWDS
NT seq 10872 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacatgtctttaccttttctttggagtttgcttaccttattaatatttgctgaa
gtaaatggcgaagctggagaacttgagctgcagagacaaaaaagaagcatcaatctccaa
cagcctcgaatggctacagagagaggaaatttggtgtttcttacggggtctgctcaaaac
attgagtttagaaccggatccctgggaaaaattaaattaaatgatgaagatctcagtgag
tgtttacatcagatccagaaaaacaaagaagatattatagagttaaaagggagtgcaatt
ggtctgcctcaaaatatatctagtcaaatctatcagcttaattccaagctggtggatctt
gagagaaaattccaaggcttgcagcagactgttgacaaaaaggtttgcagcagcaatcct
tgccagaatggtggaacctgcctcaatctgcatgattcctttttttgtatctgtccccca
cagtggaagggtcctctctgctcagctgatgttaacgaatgtgagatttactcaggaaca
cccttgagctgccagaatggaggcacatgtgttaatacaatgggaagttacagttgtcac
tgcccacctgagacgtacggaccccagtgtgcatccaaatatgacgactgtgaagggggt
tctgtggcacgctgtgtccatggcatctgtgaggatttaatgcgagagcaagctggagag
cccaagtacagctgcgtctgtgatgctgggtggatgttttcacccaacagccctgcctgc
acgctggacagagacgagtgcagcttccagcccgggccttgctccacacttgtgcagtgt
ttcaacactcaaggctctttctactgtggggcctgtccaacaggctggcaaggcaatgga
tatatttgcgaagatatcaatgaatgtgagataaataacggcggctgttctgtggctcca
cccgttgagtgtgtgaatacacctgggtcttcccactgccaggcctgtccaccagggtac
cagggtgacggaagagtgtgcacactcacagacatctgctcagtcagtaatggaggctgc
cacccagatgcctcatgctcctcaactctaggttccttacctctctgcacgtgtctcccg
ggttatactggaaatggttatgggccaaatggatgtgtgcagctcagtaatatttgccta
agtcacccctgtctaaatggacaatgcatcgacactgtctctggttatttttgtaagtgt
gactcaggttggacaggtgtcaactgtacagaaaacatcaatgagtgtttgagcaacccc
tgtttgaatggaggaacttgtgttgatggcgttgattctttcagttgtgaatgcacacgt
ctctggactggagctctctgtcaggttcctcagcaagtttgtggagagtccctctcagga
ataaatggaagcttcagctacaggagcccggatgttggttatgttcatgatgttaactgc
ttctgggttatcaaaactgaaatgggaaaggtcctgcgtatcactttcacttttttccgg
ttagaatccatggacaactgtccacacgagtttcttcaggtttatgatggagattcctct
tctgcttttcaacttggaagattttgtggctccagcctccctcatgaactcctcagcagt
gacaatgctctctattttcatctctattctgaacatttaagaaatgggagaggctttaca
gtaagatgggaaacacagcaaccagagtgtggaggtatcctgactggtccttacggttct
attaagtctccggggtatcctggaaactatcccccaggaagagattgtgtctggattgtt
gtaactagtcctgacctcctggtaacatttacttttgggaccttgagcctcgagcaccat
gatgactgcaacaaagattaccttgagattcgagatggtcctttgtatcaggaccccctt
cttgggaagttctgcaccactttctctgtcccaccgctccagactactggcccctttgcc
agaattcacttccattcagactcccagattagtgaccaaggcttccatatcacctactta
acatcaccttcggatctgcgttgtggtgggaactacacggacccagagggtgaactcttc
ttgcctgagttgtctgggcctttcactcacaccaggcaatgcgtctatatgatgaagcag
ccccagggagaacaaatacaaatcaacttcacccacgtggagctgcaatgccagagtgac
agttctcagaattacattgaggttcgagatggtgaaaccttacttggaaaagtctgtggc
aacggaaccatctctcacattaaatccattactaatagtgtctggatcaggtttaaaata
gatgcttctgttgaaaaagctagtttcagagctgtttatcaagtcgcttgcggggatgaa
ttaactggagaaggggtcattcgctcgcctttttttcctaacgtgtatcctggagaaaga
acctgtaggtggaccatccaccagccccaaagccaagtcattctcctcaacttcactgtc
tttgaaattggaagttctgcccactgtgaaacagattatgttgagattggtagcagttcc
attttgggttctcctgaaaataaaaagtattgcggtacagacataccttcatttataaca
tctgtgtacaattttctttatgtcacattcgtgaaaagttcttctactgaaaaccatggt
ttcatggctaagttcagtgctgaggatttggcatgtggagaaattcttacagaatcaaca
gggaccattcaaagtcctggccatccaaatgtctacccccacggtatcaactgtacttgg
catatattagtccaacctaatcacctgattcatttaatgttcgaaacatttcatctggag
tttcattacaattgcacaaacgactacttggaagtttatgacaccgactctgagacatcc
cttggaagatactgtggaaagtcgatcccgccatctctcacaagcagtggtaactcattg
atgctggtgtttgtgactgactccgacctcgcttatgaaggcttcttaataaactatgaa
gcaatcagtgcagcaacagcatgtttgcaagactacacagatgatttggggacattcact
tctccaaacttccccaataattatcccaacaactgggaatgcatttatcggatcacagtg
agaactggccaactgattgcagtgcacttcacaaacttctccttggaggaagccattgga
aactattatacagattttctggaaatcagagatggaggctatgaaaaatcaccattgctg
ggaatattctatggctcaaatctacccccaacaatcatctctcatagtaacaaactatgg
ttaaaatttaagagtgaccaaatagacacaaggtctggattctcagcttactgggatggg
tcatcaacaggttgcgggggtaatctcaccacttcaagcggcacgttcatatctcccaac
tacccgatgccctattaccacagctctgaatgctactggtggttgaaatctagccacggc
agcgcatttgaactggaattcaaagactttcacttggagcatcatccaaactgcacttta
gattacctggctgtatatgatggcccaagtagcaactctcatctgctaactcagctttgt
ggggatgagaaaccccctcttattcgttctagtggagacagcatgtttataaaactgagg
acagatgaaggtcagcaaggacgtggcttcaaggctgaataccggcagacatgtgagaat
gtggtaatagtcaatcaaacctatggcatcttagagagtatagggtatccgaatccttat
tctgaaaatcagcattgcaactggaccatccgggcaacaacaggcaacactgtgaactac
acatttttagcatttgacttggaacatcacataaactgctccacagattatttagagctc
tatgatggaccacggcagatgggacgctactgtggagtagacctgccccctccagggagt
actacaagctccaagcttcaagtgctgctccttacagatggggttggccgccgtgagaaa
ggatttcagatgcagtggtttgtttacggttgtggtggagagctgtctggggccacaggc
tccttcagcagccccgggttccccaacaggtatccaccaaacaaggagtgtatctggtac
attaggacggaccccgggagtagcattcagctcaccatccatgacttcgatgtggagtat
cattcaaggtgcaactttgatgtcttggagatctatggaggccccgatttccactctccc
agaatagcccaactgtgtacccagagatcacctgagaaccccatgcaggtctccagcact
ggaaatgagctagcaattcgattcaagaccgacttgtccataaatgggagaggcttcaat
gcgtcatggcaagcagtcactggaggttgtggtgggattttccaggctcccagtggagag
attcattctccaaattaccccagtccttataggagcaacacagactgttcttgggtcatt
cgggttgacagaaatcatcgtgttctcttgaacttcactgactttgatcttgaaccacaa
gactcttgtattatggcatacgatggcttaagctccacaatgtcccgccttgccaggacg
tgtggaagggagcagctggctaaccccatcgtctcctcaggaaacagcctcttcttgaga
tttcagtctggcccttccagacagaacagaggcttccgagctcaattcaggcaagcctgc
ggaggccacatcctcaccagctcatttgatactgtttcctctccacggttccctgccaat
tatccaaacaatcagaactgcagctggatcattcaagcgcaacctccattaaatcatatc
accctctcttttacccactttgaacttgaaagaagcacaacgtgtgcacgtgactttgta
gaaattttggatggcggccacgaagacgcgcccctccgaggccgttactgtggcaccgac
atgccccatcctatcacatccttcagcagcgccctgacgctgagattcgtctctgattct
agcatcagtgctgggggtttccacaccacggtcaccgcatcagtgtcggcttgtggtgga
acgttctacatggctgaaggcatcttcaacagccctggctacccagacatttatccccct
aatgtggaatgtgtctggaacatcgtcagttcccctggcaaccggctccagctgtctttt
atatctttccagttggaagactctcaggactgcagcagagattttgtggagatccgtgaa
ggaaatgccacgggtcacttggtgggacgatactgtggaaactccttccctctcaattat
tcttccatcgttggacataccctgtgggtcagatttatctcagatggttctggcagcggc
acgggcttccaggccacatttatgaagatatttggcaatgataatattgtgggaactcat
gggaaagtcgcctctcctttctggcctgaaaactacccacataactccaattaccaatgg
acagtaaatgtgaatgcatctcacgttgtccatggtagaatcttggagatggacatagaa
gaaatacaaaactgctattatgacaaattaaggatctatgatgggcctagcattcacgcc
cgcctaattggagcttactgtggtacccagactgaatctttcagctccactggaaattct
ttgacatttcatttttactccgactcttcaatctcagggaagggattccttctggagtgg
tttgcagtggatgcacctgatggtgttttacctaccattgctccaggtgcttgtggtggc
ttcctgaggacgggagatgcacccgtgtttctcttctccccgggctggcctgacagttac
agtaatagagtggactgtacgtggctcatccaggctcccgactctaccgtggaactcaac
attctttccctggacattgaatctcaccgaacgtgtgcctatgatagccttgtgatacga
gatggagataataacttggcccagcagctagcagttctctgtggcagagagatccctggg
cccatccggtctactggagagtacatgttcatccgcttcacctcggactccagtgtaacc
agggcaggcttcaatgcatcctttcacaagagctgcggtggatatttgcatgcagacaga
gggatcatcacgtcccccaagtatccagagacttacccatccaacctcaactgttcttgg
cacgtcctggtccaaagtggcctgaccattgctgtccattttgaacagcctttccagatt
ccaaatggagattcttcttgcaaccagggggattacttggtgctaagaaatggtcctgat
atctgttctccacccttgggaccccctggaggaaatggtcatttttgtggcagtcatgct
tcatcaactctgttcacctcggataatcaaatgtttgttcagtttatttctgatcacagt
aatgaagggcaaggatttaaaatcaaatatgaggcaaagagtttagcctgtgggggcaac
gtctacatccatgatgctgattctgctgggtatgtgacctcccccaaccaccctcataat
tatcccccgcacgctgattgcatttggatcttagcggctccaccggaaacacgcatacag
ctgcaatttgaagatcgattcgatattgaagtaacacccaactgtacttccaactacctt
gagttgcgggatggagtggattcggatgcaccaatactttccaaattttgtgggacatct
ttgcccagcagtcagtggtcctcaggagaggttatgtatttgagatttcgatctgacaac
agccccacacatgtgggattcaaggccaagtattctatagctcagtgtgggggaagagta
ccagggcaaagtggtgttgttgaaagcattggacatccaacacttccatacagagacaac
ttattctgtgagtggcatctccaggggctctctggacactatctcaccatctcttttgaa
gactttaaccttcagaattcttctggctgtgaaaaagacttcgtggagatctgggacaat
catacctctggaaacatcttgggcagatactgtggaaacaccattcctgacagcatagac
acttctagcaatactgctgtggtcaggtttgtcacagacggctctgtgactgcctcagga
ttcagactgcgatttgaatccagtatggaagagtgtggtggggatcttcagggctctatt
ggaacatttacttctcccaactacccgaacccaaatcctcatggccggatctgcgagtgg
agaatcactgccccggagggaaggcggatcaccctaatgtttaacaacctgaggctggcc
acgcatccgtcctgcaacaatgagcatgtgatagtattcaatggcattagaagtaactca
ccccagctagagaaactgtgtagtagtgtgaatgtaagcaatgagattaaatcttcagga
aacacaatgaaagtcatttttttcacggatggatccaggccatatggcggcttcactgct
tcctatacctccagtgaagatgcagtgtgtggtgggtctcttccaaatactcctgaagga
aactttacttctcctggctatgacggagtcaggaattactcaagaaacctgaactgcgaa
tggactctcagcaatccaaatcagggaaattcatccatttccattcactttgaagatttt
tacctagaaagtcaccaagactgtcaatttgatgtcctcgagtttcgagtgggtgatgct
gatgggcccctgatgtggagactttgtggtccttcaaagcctacattgccattggttata
ccttattctcaggtatggattcactttgtcaccaacgaacgtgtagaacacattggattc
catgcaaagtattcctttacagattgtggcggaatacagataggtgacagtggagtgatc
acaagccccaactatccaaatgcttatgacagcctgacccactgctcttcgctgttggag
gccccacaagggcacaccatcactctcacatttagtgactttgatattgaaccccataca
acttgtgcttgggactctgtcactgtcaggaatggtgggtcccctgaatcacccatcata
ggacaatactgtggaaattcaaaccccaggacaatacagtcaggttccaatcagctggtc
gtgacttttaactcagaccattcattgcaaggtggtggattttatgctacgtggaacaca
caaactttaggttgtggtggaatatttcattctgataatggtacaatcagatcccctcac
tggcctcagaattttcccgaaaacagcagatgttcctggacggccattactcacaaaagt
aaacacttggagatcagctttgacaacaacttcctaatccccagcggtgatggacaatgt
cagaatagcttcgtgaaggtgtgggcaggaactgaggaggtggacaaagccctgctagcc
actggctgtgggaacgtggctccgggtcccgttatcacaccaagtaacacattcactgcc
gtcttccagtctcaggaggcaccagctcagggcttctccgcgtcctttgttagccgatgt
ggaagtaatttcactggcccttcaggttacatcatttctccaaattacccaaaacaatat
gacaacaacatgaattgcacctatgtcatagaggctaatcctctgtcagtggtcctcttg
acttttgtgtccttccacttagaagctcgttccgctgtgacgggaagctgtgtcaacgat
ggcgtgcacattatcagaggttacagcgtcatgtccaccccatttgctactgtgtgtggg
gatgagatgccagctcccctcaccatcgctgggccggttctgcttaacttctactccaac
gagcaaatcacagacttcggattcaagttttcctataggataatctcctgtggtggtgtg
ttcaatttctcttctggaatcatcacaagtcctgcctattcatacgcagactacccaaat
gatatgcactgtctgtataccatcaccgttagtgacgacaaggtgatcgagctcaagttc
agtgattttgatgtggttccctccacctcctgctcccatgactacctggcaatttacgat
ggtgccaataccagcgatccccttcttggcaaattctgcggttccaagcgcccaccaaat
gtgaagagcagcaataatagtatgctcctggtgttcaagacagattcatttcagacagca
aaaggctggaagatgtctttccggcagacattggggcctcagcaaggatgtggtggttat
ctgacaggctcgaataatacctttgcctctcctgattctgattcgaatggaatgtatgac
aagaatttaaactgtgtatggatcataattgcacctgtaaacaaagtaattcacctcacc
ttcaatacatttgctctggaggcagcaagtactaggcaaagatgcctttatgattatgta
aagttatatgatggggatagtgaaaatgcgaacttggctggaacgttttgtggttccaca
gtacctgctccttttatctcttctggtaacttccttacggttcaattcatcagtgactta
acattagagagggaaggatttaatgctacatacaccatcatggacatgccttgtggtgga
acatacaatgcaacttggaccccacaaaatatttcatcacccaattcatcagacccagat
gtcccattttccatctgtacttgggtcattgattcccctccgcatcagcaggtcaagata
actgtgtgggcattacagctgacctcgcaagactgcacgcagaattacttacagcttcag
gactcaccgcagggtcacggaaattcaagatttcagttctgtggcagaaatgcttcggct
gtgccagtgttttattcttctatgagtactgcaatggtcattttcaaatctggagttgta
aacagaaactctagaatgagtttcacctatcagattgcagattgcaacagagactatcac
aaggcatttggcaacctgagaagccctggatggccagataactacgacaatgacaaggat
tgcaccgttactctcacagccccccagaaccacaccatttccctcttttttcattcactt
ggcatcgagaactcagttgaatgcagaaacgatttcttggaggtgagaaatggaagtaac
agcaattcaccattactgggcaagtactgtggaactctgctgccaaaccctgtcttctct
caaaataatgaactatacctacgatttaagagtgatagtgtaacttctgatcgtggatat
gaaatcatctggacttcatcaccctctggatgtggtggaactctttatggagacagaggc
tcattcaccagccccggctatccaggcacatacccaaacaacacgtactgcgagtgggtc
cttgttgctcctgctggaaggcttgtcaccatcaacttctacttcatcagcattgacgat
ccaggagactgtgtccagaactatctcacactctatgatgggcccaacgccagctctcca
tcctctggaccatactgcggaggcgacaccagcatagctcccttcgtggcttcctcaaat
caggtcttcataaaatttcatgctgattatgcacggcgtccatccgcattccgattaact
tgggacagctaa

DBGET integrated database retrieval system