KEGG   Homo sapiens (human): 8029Help
Entry
8029              CDS       T01001                                 

Gene name
CUBN, IFCR, MGA1, gp280
Definition
(RefSeq) cubilin
  KO
K14616  
cubilin
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H01277  
Vitamin B12 deficiency anaemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    8029 (CUBN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8029 (CUBN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10p12.31
AA seq 3623 aa AA seqDB search
MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKEDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGE
PKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKC
DSGWTGVNCTENINECLSNPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPECGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRQMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEY
HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN
ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ
DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC
GGHILTSSFDTVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV
EILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGG
TFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE
GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH
GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA
RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG
FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR
DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR
GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD
ICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN
VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL
ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRV
PGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDN
HTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSI
GTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNS
PQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSLPNTPEG
NFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQDCQFDVLEFRVGDA
DGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVI
TSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPII
GQYCGNSNPRTIQSGSNQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSDNGTIRSPH
WPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLA
TGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQY
DNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCG
DEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSGIITSPAYSYADYPN
DMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPN
VKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGMYD
KNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGST
VPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISSPNSSDPD
VPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASA
VPVFYSSMSTAMVIFKSGVVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKD
CTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFS
QNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWV
LVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSN
QVFIKFHADYARRPSAFRLTWDS
NT seq 10872 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacatgtctttaccttttctttggagtttgcttaccttattaatatttgctgaa
gtaaatggcgaagctggagaacttgagctgcagagacaaaaaagaagcatcaatctccaa
cagcctcgaatggctacagagagaggaaatttggtgtttcttacggggtctgctcaaaac
attgagtttagaaccggatccctgggaaaaattaaattaaatgatgaagatctcagtgag
tgtttacatcagatccagaaaaacaaagaagatattatagagttaaaagggagtgcaatt
ggtctgcctcaaaatatatctagtcaaatctatcagcttaattccaagctggtggatctt
gagagaaaattccaaggcttgcagcagactgttgacaaaaaggtttgcagcagcaatcct
tgccagaatggtggaacctgcctcaatctgcatgattcctttttttgtatctgtccccca
cagtggaagggtcctctctgctcagctgatgttaacgaatgtgagatttactcaggaaca
cccttgagctgccagaatggaggcacatgtgttaatacaatgggaagttacagttgtcac
tgcccacctgagacgtacggaccccagtgtgcatccaaatatgacgactgtgaagggggt
tctgtggcacgctgtgtccatggcatctgtgaggatttaatgcgagagcaagctggagag
cccaagtacagctgcgtctgtgatgctgggtggatgttttcacccaacagccctgcctgc
acgctggacagagacgagtgcagcttccagcccgggccttgctccacacttgtgcagtgt
ttcaacactcaaggctctttctactgtggggcctgtccaacaggctggcaaggcaatgga
tatatttgcgaagatatcaatgaatgtgagataaataacggcggctgttctgtggctcca
cccgttgagtgtgtgaatacacctgggtcttcccactgccaggcctgtccaccagggtac
cagggtgacggaagagtgtgcacactcacagacatctgctcagtcagtaatggaggctgc
cacccagatgcctcatgctcctcaactctaggttccttacctctctgcacgtgtctcccg
ggttatactggaaatggttatgggccaaatggatgtgtgcagctcagtaatatttgccta
agtcacccctgtctaaatggacaatgcatcgacactgtctctggttatttttgtaagtgt
gactcaggttggacaggtgtcaactgtacagaaaacatcaatgagtgtttgagcaacccc
tgtttgaatggaggaacttgtgttgatggcgttgattctttcagttgtgaatgcacacgt
ctctggactggagctctctgtcaggttcctcagcaagtttgtggagagtccctctcagga
ataaatggaagcttcagctacaggagcccggatgttggttatgttcatgatgttaactgc
ttctgggttatcaaaactgaaatgggaaaggtcctgcgtatcactttcacttttttccgg
ttagaatccatggacaactgtccacacgagtttcttcaggtttatgatggagattcctct
tctgcttttcaacttggaagattttgtggctccagcctccctcatgaactcctcagcagt
gacaatgctctctattttcatctctattctgaacatttaagaaatgggagaggctttaca
gtaagatgggaaacacagcaaccagagtgtggaggtatcctgactggtccttacggttct
attaagtctccggggtatcctggaaactatcccccaggaagagattgtgtctggattgtt
gtaactagtcctgacctcctggtaacatttacttttgggaccttgagcctcgagcaccat
gatgactgcaacaaagattaccttgagattcgagatggtcctttgtatcaggaccccctt
cttgggaagttctgcaccactttctctgtcccaccgctccagactactggcccctttgcc
agaattcacttccattcagactcccagattagtgaccaaggcttccatatcacctactta
acatcaccttcggatctgcgttgtggtgggaactacacggacccagagggtgaactcttc
ttgcctgagttgtctgggcctttcactcacaccaggcaatgcgtctatatgatgaagcag
ccccagggagaacaaatacaaatcaacttcacccacgtggagctgcaatgccagagtgac
agttctcagaattacattgaggttcgagatggtgaaaccttacttggaaaagtctgtggc
aacggaaccatctctcacattaaatccattactaatagtgtctggatcaggtttaaaata
gatgcttctgttgaaaaagctagtttcagagctgtttatcaagtcgcttgcggggatgaa
ttaactggagaaggggtcattcgctcgcctttttttcctaacgtgtatcctggagaaaga
acctgtaggtggaccatccaccagccccaaagccaagtcattctcctcaacttcactgtc
tttgaaattggaagttctgcccactgtgaaacagattatgttgagattggtagcagttcc
attttgggttctcctgaaaataaaaagtattgcggtacagacataccttcatttataaca
tctgtgtacaattttctttatgtcacattcgtgaaaagttcttctactgaaaaccatggt
ttcatggctaagttcagtgctgaggatttggcatgtggagaaattcttacagaatcaaca
gggaccattcaaagtcctggccatccaaatgtctacccccacggtatcaactgtacttgg
catatattagtccaacctaatcacctgattcatttaatgttcgaaacatttcatctggag
tttcattacaattgcacaaacgactacttggaagtttatgacaccgactctgagacatcc
cttggaagatactgtggaaagtcgatcccgccatctctcacaagcagtggtaactcattg
atgctggtgtttgtgactgactccgacctcgcttatgaaggcttcttaataaactatgaa
gcaatcagtgcagcaacagcatgtttgcaagactacacagatgatttggggacattcact
tctccaaacttccccaataattatcccaacaactgggaatgcatttatcggatcacagtg
agaactggccaactgattgcagtgcacttcacaaacttctccttggaggaagccattgga
aactattatacagattttctggaaatcagagatggaggctatgaaaaatcaccattgctg
ggaatattctatggctcaaatctacccccaacaatcatctctcatagtaacaaactatgg
ttaaaatttaagagtgaccaaatagacacaaggtctggattctcagcttactgggatggg
tcatcaacaggttgcgggggtaatctcaccacttcaagcggcacgttcatatctcccaac
tacccgatgccctattaccacagctctgaatgctactggtggttgaaatctagccacggc
agcgcatttgaactggaattcaaagactttcacttggagcatcatccaaactgcacttta
gattacctggctgtatatgatggcccaagtagcaactctcatctgctaactcagctttgt
ggggatgagaaaccccctcttattcgttctagtggagacagcatgtttataaaactgagg
acagatgaaggtcagcaaggacgtggcttcaaggctgaataccggcagacatgtgagaat
gtggtaatagtcaatcaaacctatggcatcttagagagtatagggtatccgaatccttat
tctgaaaatcagcattgcaactggaccatccgggcaacaacaggcaacactgtgaactac
acatttttagcatttgacttggaacatcacataaactgctccacagattatttagagctc
tatgatggaccacggcagatgggacgctactgtggagtagacctgccccctccagggagt
actacaagctccaagcttcaagtgctgctccttacagatggggttggccgccgtgagaaa
ggatttcagatgcagtggtttgtttacggttgtggtggagagctgtctggggccacaggc
tccttcagcagccccgggttccccaacaggtatccaccaaacaaggagtgtatctggtac
attaggacggaccccgggagtagcattcagctcaccatccatgacttcgatgtggagtat
cattcaaggtgcaactttgatgtcttggagatctatggaggccccgatttccactctccc
agaatagcccaactgtgtacccagagatcacctgagaaccccatgcaggtctccagcact
ggaaatgagctagcaattcgattcaagaccgacttgtccataaatgggagaggcttcaat
gcgtcatggcaagcagtcactggaggttgtggtgggattttccaggctcccagtggagag
attcattctccaaattaccccagtccttataggagcaacacagactgttcttgggtcatt
cgggttgacagaaatcatcgtgttctcttgaacttcactgactttgatcttgaaccacaa
gactcttgtattatggcatacgatggcttaagctccacaatgtcccgccttgccaggacg
tgtggaagggagcagctggctaaccccatcgtctcctcaggaaacagcctcttcttgaga
tttcagtctggcccttccagacagaacagaggcttccgagctcaattcaggcaagcctgc
ggaggccacatcctcaccagctcatttgatactgtttcctctccacggttccctgccaat
tatccaaacaatcagaactgcagctggatcattcaagcgcaacctccattaaatcatatc
accctctcttttacccactttgaacttgaaagaagcacaacgtgtgcacgtgactttgta
gaaattttggatggcggccacgaagacgcgcccctccgaggccgttactgtggcaccgac
atgccccatcctatcacatccttcagcagcgccctgacgctgagattcgtctctgattct
agcatcagtgctgggggtttccacaccacggtcaccgcatcagtgtcggcttgtggtgga
acgttctacatggctgaaggcatcttcaacagccctggctacccagacatttatccccct
aatgtggaatgtgtctggaacatcgtcagttcccctggcaaccggctccagctgtctttt
atatctttccagttggaagactctcaggactgcagcagagattttgtggagatccgtgaa
ggaaatgccacgggtcacttggtgggacgatactgtggaaactccttccctctcaattat
tcttccatcgttggacataccctgtgggtcagatttatctcagatggttctggcagcggc
acgggcttccaggccacatttatgaagatatttggcaatgataatattgtgggaactcat
gggaaagtcgcctctcctttctggcctgaaaactacccacataactccaattaccaatgg
acagtaaatgtgaatgcatctcacgttgtccatggtagaatcttggagatggacatagaa
gaaatacaaaactgctattatgacaaattaaggatctatgatgggcctagcattcacgcc
cgcctaattggagcttactgtggtacccagactgaatctttcagctccactggaaattct
ttgacatttcatttttactccgactcttcaatctcagggaagggattccttctggagtgg
tttgcagtggatgcacctgatggtgttttacctaccattgctccaggtgcttgtggtggc
ttcctgaggacgggagatgcacccgtgtttctcttctccccgggctggcctgacagttac
agtaatagagtggactgtacgtggctcatccaggctcccgactctaccgtggaactcaac
attctttccctggacattgaatctcaccgaacgtgtgcctatgatagccttgtgatacga
gatggagataataacttggcccagcagctagcagttctctgtggcagagagatccctggg
cccatccggtctactggagagtacatgttcatccgcttcacctcggactccagtgtaacc
agggcaggcttcaatgcatcctttcacaagagctgcggtggatatttgcatgcagacaga
gggatcatcacgtcccccaagtatccagagacttacccatccaacctcaactgttcttgg
cacgtcctggtccaaagtggcctgaccattgctgtccattttgaacagcctttccagatt
ccaaatggagattcttcttgcaaccagggggattacttggtgctaagaaatggtcctgat
atctgttctccacccttgggaccccctggaggaaatggtcatttttgtggcagtcatgct
tcatcaactctgttcacctcggataatcaaatgtttgttcagtttatttctgatcacagt
aatgaagggcaaggatttaaaatcaaatatgaggcaaagagtttagcctgtgggggcaac
gtctacatccatgatgctgattctgctgggtatgtgacctcccccaaccaccctcataat
tatcccccgcacgctgattgcatttggatcttagcggctccaccggaaacacgcatacag
ctgcaatttgaagatcgattcgatattgaagtaacacccaactgtacttccaactacctt
gagttgcgggatggagtggattcggatgcaccaatactttccaaattttgtgggacatct
ttgcccagcagtcagtggtcctcaggagaggttatgtatttgagatttcgatctgacaac
agccccacacatgtgggattcaaggccaagtattctatagctcagtgtgggggaagagta
ccagggcaaagtggtgttgttgaaagcattggacatccaacacttccatacagagacaac
ttattctgtgagtggcatctccaggggctctctggacactatctcaccatctcttttgaa
gactttaaccttcagaattcttctggctgtgaaaaagacttcgtggagatctgggacaat
catacctctggaaacatcttgggcagatactgtggaaacaccattcctgacagcatagac
acttctagcaatactgctgtggtcaggtttgtcacagacggctctgtgactgcctcagga
ttcagactgcgatttgaatccagtatggaagagtgtggtggggatcttcagggctctatt
ggaacatttacttctcccaactacccgaacccaaatcctcatggccggatctgcgagtgg
agaatcactgccccggagggaaggcggatcaccctaatgtttaacaacctgaggctggcc
acgcatccgtcctgcaacaatgagcatgtgatagtattcaatggcattagaagtaactca
ccccagctagagaaactgtgtagtagtgtgaatgtaagcaatgagattaaatcttcagga
aacacaatgaaagtcatttttttcacggatggatccaggccatatggcggcttcactgct
tcctatacctccagtgaagatgcagtgtgtggtgggtctcttccaaatactcctgaagga
aactttacttctcctggctatgacggagtcaggaattactcaagaaacctgaactgcgaa
tggactctcagcaatccaaatcagggaaattcatccatttccattcactttgaagatttt
tacctagaaagtcaccaagactgtcaatttgatgtcctcgagtttcgagtgggtgatgct
gatgggcccctgatgtggagactttgtggtccttcaaagcctacattgccattggttata
ccttattctcaggtatggattcactttgtcaccaacgaacgtgtagaacacattggattc
catgcaaagtattcctttacagattgtggcggaatacagataggtgacagtggagtgatc
acaagccccaactatccaaatgcttatgacagcctgacccactgctcttcgctgttggag
gccccacaagggcacaccatcactctcacatttagtgactttgatattgaaccccataca
acttgtgcttgggactctgtcactgtcaggaatggtgggtcccctgaatcacccatcata
ggacaatactgtggaaattcaaaccccaggacaatacagtcaggttccaatcagctggtc
gtgacttttaactcagaccattcattgcaaggtggtggattttatgctacgtggaacaca
caaactttaggttgtggtggaatatttcattctgataatggtacaatcagatcccctcac
tggcctcagaattttcccgaaaacagcagatgttcctggacggccattactcacaaaagt
aaacacttggagatcagctttgacaacaacttcctaatccccagcggtgatggacaatgt
cagaatagcttcgtgaaggtgtgggcaggaactgaggaggtggacaaagccctgctagcc
actggctgtgggaacgtggctccgggtcccgttatcacaccaagtaacacattcactgcc
gtcttccagtctcaggaggcaccagctcagggcttctccgcgtcctttgttagccgatgt
ggaagtaatttcactggcccttcaggttacatcatttctccaaattacccaaaacaatat
gacaacaacatgaattgcacctatgtcatagaggctaatcctctgtcagtggtcctcttg
acttttgtgtccttccacttagaagctcgttccgctgtgacgggaagctgtgtcaacgat
ggcgtgcacattatcagaggttacagcgtcatgtccaccccatttgctactgtgtgtggg
gatgagatgccagctcccctcaccatcgctgggccggttctgcttaacttctactccaac
gagcaaatcacagacttcggattcaagttttcctataggataatctcctgtggtggtgtg
ttcaatttctcttctggaatcatcacaagtcctgcctattcatacgcagactacccaaat
gatatgcactgtctgtataccatcaccgttagtgacgacaaggtgatcgagctcaagttc
agtgattttgatgtggttccctccacctcctgctcccatgactacctggcaatttacgat
ggtgccaataccagcgatccccttcttggcaaattctgcggttccaagcgcccaccaaat
gtgaagagcagcaataatagtatgctcctggtgttcaagacagattcatttcagacagca
aaaggctggaagatgtctttccggcagacattggggcctcagcaaggatgtggtggttat
ctgacaggctcgaataatacctttgcctctcctgattctgattcgaatggaatgtatgac
aagaatttaaactgtgtatggatcataattgcacctgtaaacaaagtaattcacctcacc
ttcaatacatttgctctggaggcagcaagtactaggcaaagatgcctttatgattatgta
aagttatatgatggggatagtgaaaatgcgaacttggctggaacgttttgtggttccaca
gtacctgctccttttatctcttctggtaacttccttacggttcaattcatcagtgactta
acattagagagggaaggatttaatgctacatacaccatcatggacatgccttgtggtgga
acatacaatgcaacttggaccccacaaaatatttcatcacccaattcatcagacccagat
gtcccattttccatctgtacttgggtcattgattcccctccgcatcagcaggtcaagata
actgtgtgggcattacagctgacctcgcaagactgcacgcagaattacttacagcttcag
gactcaccgcagggtcacggaaattcaagatttcagttctgtggcagaaatgcttcggct
gtgccagtgttttattcttctatgagtactgcaatggtcattttcaaatctggagttgta
aacagaaactctagaatgagtttcacctatcagattgcagattgcaacagagactatcac
aaggcatttggcaacctgagaagccctggatggccagataactacgacaatgacaaggat
tgcaccgttactctcacagccccccagaaccacaccatttccctcttttttcattcactt
ggcatcgagaactcagttgaatgcagaaacgatttcttggaggtgagaaatggaagtaac
agcaattcaccattactgggcaagtactgtggaactctgctgccaaaccctgtcttctct
caaaataatgaactatacctacgatttaagagtgatagtgtaacttctgatcgtggatat
gaaatcatctggacttcatcaccctctggatgtggtggaactctttatggagacagaggc
tcattcaccagccccggctatccaggcacatacccaaacaacacgtactgcgagtgggtc
cttgttgctcctgctggaaggcttgtcaccatcaacttctacttcatcagcattgacgat
ccaggagactgtgtccagaactatctcacactctatgatgggcccaacgccagctctcca
tcctctggaccatactgcggaggcgacaccagcatagctcccttcgtggcttcctcaaat
caggtcttcataaaatttcatgctgattatgcacggcgtccatccgcattccgattaact
tgggacagctaa

DBGET integrated database retrieval system