KEGG   Homo sapiens (human): 80331Help
Entry
80331             CDS       T01001                                 

Gene name
DNAJC5, CLN4, CLN4B, CSP, DNAJC5A, NCL
Definition
DnaJ (Hsp40) homolog, subfamily C, member 5
Orthology
K09525  
DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
20q13.33
AA seq 198 aa AA seqDB search
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI
NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCY
CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE
TTQLTADSHPSYHTDGFN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagacagcgctcactgtctacctctggggagtcattgtaccacgtcctt
gggttggacaagaacgcaacctcagatgacattaaaaagtcctatcggaagcttgccttg
aaatatcaccccgacaagaaccccgacaacccggaggccgcggacaagtttaaggagatc
aacaacgcgcacgccatcctcacggacgccacaaaaaggaacatctacgacaagtacggc
tcgctgggtctctacgtggccgagcagtttggggaagagaacgtgaacacctacttcgtg
ctgtccagctggtgggccaaggccctgtttgtcttctgcggcctcctcacgtgctgctac
tgctgctgctgtctgtgctgctgcttcaactgctgctgcgggaagtgtaagcccaaggcg
cctgaaggcgaggagacggagttctacgtgtcccccgaggatctggaggcacagctgcag
tctgacgagagggaggccacagacacgccgatcgtcatacagccggcatccgccaccgag
accacccagctcacagccgactcccaccccagctaccacactgacgggttcaactaa

DBGET integrated database retrieval system