KEGG   Homo sapiens (human): 80331Help
Entry
80331             CDS       T01001                                 

Gene name
DNAJC5, CLN4, CLN4B, CSP, DNAJC5A, NCL, mir-941-2, mir-941-3, mir-941-4, mir-941-5
Definition
(RefSeq) DnaJ (Hsp40) homolog, subfamily C, member 5
  KO
K09525  
DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    80331 (DNAJC5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   80331 (DNAJC5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     80331 (DNAJC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
20q13.33
AA seq 198 aa AA seqDB search
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI
NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCY
CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE
TTQLTADSHPSYHTDGFN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagacagcgctcactgtctacctctggggagtcattgtaccacgtcctt
gggttggacaagaacgcaacctcagatgacattaaaaagtcctatcggaagcttgccttg
aaatatcaccccgacaagaaccccgacaacccggaggccgcggacaagtttaaggagatc
aacaacgcgcacgccatcctcacggacgccacaaaaaggaacatctacgacaagtacggc
tcgctgggtctctacgtggccgagcagtttggggaagagaacgtgaacacctacttcgtg
ctgtccagctggtgggccaaggccctgtttgtcttctgcggcctcctcacgtgctgctac
tgctgctgctgtctgtgctgctgcttcaactgctgctgcgggaagtgtaagcccaaggcg
cctgaaggcgaggagacggagttctacgtgtcccccgaggatctggaggcacagctgcag
tctgacgagagggaggccacagacacgccgatcgtcatacagccggcatccgccaccgag
accacccagctcacagccgactcccaccccagctaccacactgacgggttcaactaa

DBGET integrated database retrieval system