KEGG   Homo sapiens (human): 80380Help
Entry
80380             CDS       T01001                                 

Gene name
PDCD1LG2, B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2, bA574F11.2
Definition
programmed cell death 1 ligand 2
Orthology
K06708  
programmed cell death 1 ligand 2
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
9p24.2
AA seq 273 aa AA seqDB search
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ
KVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK
ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL
RLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATV
IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcctcctgctaatgttgagcctggaattgcagcttcaccagatagcagcttta
ttcacagtgacagtccctaaggaactgtacataatagagcatggcagcaatgtgaccctg
gaatgcaactttgacactggaagtcatgtgaaccttggagcaataacagccagtttgcaa
aaggtggaaaatgatacatccccacaccgtgaaagagccactttgctggaggagcagctg
cccctagggaaggcctcgttccacatacctcaagtccaagtgagggacgaaggacagtac
caatgcataatcatctatggggtcgcctgggactacaagtacctgactctgaaagtcaaa
gcttcctacaggaaaataaacactcacatcctaaaggttccagaaacagatgaggtagag
ctcacctgccaggctacaggttatcctctggcagaagtatcctggccaaacgtcagcgtt
cctgccaacaccagccactccaggacccctgaaggcctctaccaggtcaccagtgttctg
cgcctaaagccaccccctggcagaaacttcagctgtgtgttctggaatactcacgtgagg
gaacttactttggccagcattgaccttcaaagtcagatggaacccaggacccatccaact
tggctgcttcacattttcatccccttctgcatcattgctttcattttcatagccacagtg
atagccctaagaaaacaactctgtcaaaagctgtattcttcaaaagacacaacaaaaaga
cctgtcaccacaacaaagagggaagtgaacagtgctatctga

DBGET integrated database retrieval system