KEGG   Homo sapiens (human): 8050Help
Entry
8050              CDS       T01001                                 

Gene name
PDHX, DLDBP, E3BP, OPDX, PDX1, proX
Definition
(RefSeq) pyruvate dehydrogenase complex component X
  KO
K13997  
dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8050 (PDHX)
   00020 Citrate cycle (TCA cycle)
    8050 (PDHX)
   00620 Pyruvate metabolism
    8050 (PDHX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11p13
AA seq 501 aa AA seqDB search
MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKIL
MPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSK
NIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTL
RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTAT
PTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPH
AYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPF
IDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL
GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDD
ELATRFLKSFKANLENPIRLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcctggaggctgggctgtgatccgcggctgctgcgttatcttgtgggcttc
cccggccgccgaagcgtagggctggtgaagggggctcttgggtggtctgtaagccgcgga
gctaattggagatggtttcacagcacgcagtggcttcggggtgatcccattaagatacta
atgccatcactgtctcctacaatggaagaaggaaacattgtgaaatggctgaaaaaggaa
ggtgaagcggtgagtgctggagatgcattatgtgaaattgagactgacaaagctgtggtt
accttagatgcaagtgatgatggaatcttggccaaaatcgtggttgaagaaggaagtaaa
aatatacggctaggttcactaattggtttgatagtagaagaaggagaagattggaaacat
gttgaaattcccaaagacgtaggtcctccaccaccagtttcaaaaccttcagagcctcgc
ccctcaccagaaccacagatttccatccctgtcaagaaggaacacatacccgggacacta
cggttccgtttaagtccagctgcccgcaatattctggaaaaacactcactggatgctagc
cagggcacagccactggccctcgggggatattcactaaagaggatgctctcaaacttgtc
cagttgaaacaaacgggcaagattaccgagtccagaccaactccagcccccacagccact
cccacagcaccttcgcccctacaggccacagctggaccatcttatccccggcctgtgatc
ccaccagtatcaactcctggacaacccaatgcagtgggcacattcactgaaatccccgcc
agcaatattcgaagagttattgccaagagattaactgaatctaaaagtactgtacctcat
gcatatgctactgctgactgtgaccttggagctgttttaaaagttaggcaagatctggtc
aaagatgacattaaagtatcagtaaatgattttatcatcaaggcagcagctgttaccctt
aaacaaatgccagatgttaatgtaagctgggatggagagggcccaaagcaactgccattt
attgacatttcagtggctgtggcaacagataaaggcttacttactccaatcataaaagat
gctgctgctaaaggtatccaggaaattgctgactctgtaaaggctctatcaaagaaagca
agagatggaaaattgttgcctgaagaataccaaggaggatcttttagtatttccaacttg
gggatgtttggcatcgacgaatttactgcagtgattaaccctcctcaggcctgcattttg
gcggttgggaggttccgacctgtgctgaagctcactgaggatgaagagggaaatgccaaa
ctgcagcagcgccagctcataacagtcacaatgtcaagtgacagtcgagtggttgatgac
gaactggcaaccaggtttcttaaaagttttaaagcaaacctagagaatcctatccgactt
gcctag

DBGET integrated database retrieval system