KEGG   Homo sapiens (human): 84464Help
Entry
84464             CDS       T01001                                 

Gene name
SLX4, BTBD12, FANCP, MUS312
Definition
(RefSeq) SLX4 structure-specific endonuclease subunit
  KO
K10484  structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    84464 (SLX4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     84464 (SLX4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     84464 (SLX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Slx4 BTB zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 84464
NCBI-ProteinID: NP_115820
OMIM: 613278
HGNC: 23845
Ensembl: ENSG00000188827
Vega: OTTHUMG00000074089
Pharos: Q8IY92(Tbio)
UniProt: Q8IY92
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 1834 aa AA seqDB search
MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQ
RVKKHGIKEVSGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRT
KKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTREN
VPNSDSQPPPSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREEN
VPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQ
KNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKM
EVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSED
LLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTG
RQIEDRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAW
AMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGP
SPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQ
DKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQY
VNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVS
ELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHE
EDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQW
DKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSS
PSRDCQAERKEGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSH
RLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPS
KQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQK
SSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCELFSIIDVDAD
QEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPAT
PLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQT
PSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPG
PSFLNQTPAGEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDH
WNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQEKSSGAGSLGN
SRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPKGANRKKNLPPKVPI
TPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSSQPL
LQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSR
SPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEV
SASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDF
LDTHCITFTTAATRREKLQGRRRQPRGKKKVERN
NT seq 5505 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagtgtgaatgaggctcagctaggcttctacttgggttcactttctcatctg
tctgcctgtcctgggattgaccctcgctcctctgaagaccagcctgaaagccttaaaact
ggtcagatgatggatgagtctgatgaggactttaaagaactctgcgctagctttttccaa
agggtgaaaaaacatggaatcaaggaagtgtcaggagaaaggaagacacaaaaggctgcc
tcaaacggcactcagataagaagcaaattgaaaaggaccaaacaaactgctaccaagacc
aaaacccttcaaggccctgcagagaagaaacctccgtctggcagccaggcccctaggact
aaaaagcaaagggtaaccaaatggcaagcaagtgaaccggcccactctgtgaatggggag
gggggtgtgcttgcctctgctccagatccacctgtgctccgggaaacagcacaaaacacc
cagacgggtaaccagcaagaaccatcgccaaacctttccagagagaaaaccagagagaat
gtgcccaacagcgactcccagcctcctccttcctgtttgacaacagcagtgccaagtccc
tccaaaccccgcacagcacaattggtcctacagcgaatgcagcagttcaagagagcagac
cccgagcgtttgagacacgcttcagaagagtgctccctcgaggctgcgcgggaagaaaat
gtcccaaaggatcctcaagaggagatgatggcggggaatgtgtatgggcttgggccccct
gccccagagagcgacgctgcggtggccttgaccctgcagcaggagtttgcacgggtagga
gcatcggcacatgatgatagcctggaggaaaagggtttgttcttctgccagatttgtcaa
aagaacctctcagccatgaacgtgacccgaagggaacagcatgtgaacaggtgcttggat
gaagctgaaaagacactaagaccttctgtgcctcagatccctgagtgcccgatttgtggg
aaaccgtttcttaccttaaagagcagaaccagtcacttgaagcagtgtgctgtgaagatg
gaggttggcccccagctcctgcttcaggctgtgcggctgcagacagcacagcctgagggt
agcagcagcccacccatgttcagcttcagtgatcacagtagaggtctgaaacggagagga
cccaccagcaagaaggagccacggaagaggcggaaggtggacgaggcaccgtccgaggac
ctgctggtggccatggctctgtcccggtcggagatggagccgggtgcggctgtaccagcg
ctcaggctggaaagtgccttttctgagaggataagaccagaagcagagaataaaagtcgc
aagaagaaacccccggtatcccccccattgttgttagtccaggactctgaaaccacaggc
cgacagatagaggaccgtgtggccctgctcctctctgaggaagtggaattgtctagcacg
ccaccacttcctgccagcaggattttaaaggaagggtgggaaagagcgggccagtgtcct
cctccacctgaacgcaagcagagctttctgtgggagggcagcgcactgactggggcctgg
gccatggaggacttctacacggccaggctggtccctcctctcgtgccccagcggcctgcc
cagggccttatgcaggagcccgtgccgcctctggtgccacctgagcactcagagctgagc
gagcgaaggtcacccgctctccacggcacccccactgcaggctgtggctccaggggcccg
tcgccttcggccagccagagggagcaccaggccctgcaggacctcgtggacctggcgagg
gagggactgagcgccagcccgtggcccggcagtgggggcctggctggctcggaagggact
gcagggttggacgtggtgcccggcggccttcctctgactgggtttgtggtgccatcgcag
gacaagcacccggacaggggcggccgcaccttgctctccctcgggctgctggttgctgac
tttggcgccatggtcaataacccacacctgagtgatgtccagtttcagacggacagcggg
gaggtgctttacgcccacaagttcgtgctttatgcccgatgcccgctcctcatccagtat
gtgaacaatgaaggcttctccgctgtagaggacggggttctgacccagcgtgtcctgctg
ggtgacgtgagcaccgaggccgcccgcacgttcctgcactatctctacactgcggacact
ggccttcctcctggccttagctctgagctgagctccctggcccacaggtttggcgtgagt
gagctcgttcacctgtgcgaacaggtgcctattgccactgactcagagggcaaaccatgg
gaggagaaggaagcagagaattgcgaaagcagggccgagaatttccaggaactcttgagg
tcaatgtgggcagatgaagaggaggaagcggagactttgttgaaatccaaggaccacgaa
gaagatcaagaaaacgtgaatgaagcagaaatggaagaaatttatgaatttgcagctact
cagcgaaagcttctccaggaagaaagggcagcgggtgccggcgaggacgctgactggctg
gagggtggcagtccggtttctgggcaactcctagcaggtgtccaggtgcagaaacagtgg
gacaaggtggaggagatggagccgttggagccaggaagagatgaggccgccaccacctgg
gagaagatgggacagtgcgctctcccgccaccccagggccagcactcaggggcacgggga
gcagaggcccctgagcaggaggcgccagaggaggcgcttggccattccagctgctccagc
ccttccagggactgccaggcagagagaaaagaaggctctcttccgcactcagatgatgcc
ggggattacgaacagctcttctcatcaactcagggagagatctcagagccgtcccaaata
acaagtgagcccgaggaacaaagtggcgctgtcagggaaagggggctggaggtttctcat
cgcctggctccctggcaggcatctccaccgcacccgtgccgcttcctattggggcctccc
cagggcgggagtccccgcgggtctcatcacacaagtgggtcgtccctgtcaacaccccgg
tcccgtggcggaacttcccaggtgggctccccaaccttgctgtctccagctgtgccatca
aagcagaaaagggacaggagcatcctcacgctgtctaaagagccagggcaccagaaaggc
aaagagcgtcggtccgtgctggagtgcagaaataagggggtcctgatgttcccagaaaaa
tctccgtctattgacctaacccagtcaaatcctgaccattcgagctccagatctcagaaa
tcttcatccaaactgaacgaagaagatgaggtcatcctcttactggactcggatgaggag
ctggagctagaacaaaccaaaatgaagtccatttctagtgatcctctggaagaaaagaaa
gctctagaaattagccctaggtcctgtgagctgttttccatcattgatgttgatgcagat
caggaaccttcccagagcccaccaagaagcgaagctgtgctgcagcaggaggatgagggg
gcgctgccggagaatcggggctctttgggcaggagaggggctccctggctgttctgtgac
cgtgagagcagccccagcgaggccagcaccacagacacctcgtggctggtgcccgccacc
ccgctggccagcagaagccgtgactgttcttcccagacccaaatcagcagcctcaggagc
gggctggccgtgcaggcggtgactcagcacacgcccagggcctcagtaggaaacagggaa
gggaacgaagtcgcacagaagttttctgtcatcaggccccagacaccaccgccccagaca
ccgtcctcatgcctcactcccgtctctccaggaacttctgacggcagaaggcaaggccac
agaagcccttcccgtccccaccccgggggccacccgcactcctctccgctggctccacat
cccatctcaggggaccgcgcccacttcagcaggcggttcctgaaacactcgccgcctggg
ccaagcttcctgaaccagaccccagcgggtgaagtggtggaagtcggagacagtgacgat
gagcaggaggtggcctcccatcaggccaacagaagccccccactggacagtgacccccca
attccaattgacgactgctgctggcacatggagcccctctcgccaattcccattgaccac
tggaacctggagcggaccggccccctgagcaccagcagccccagccgcaggatgaacgag
gccgccgacagccgtgactgtcgctccccgggactcctggacaccacccccatccgagga
agctgcactacccagaggaaattgcaagagaagtcctcgggcgcgggctccctggggaat
agcaggccgagctttctgaattcggctctgtgggacgtttgggacggggaagagcagagg
cctccagagacccctcctccggcccagatgccaagcgctggtggagctcagaagcccgaa
gggttagagacacccaaaggtgctaatcggaagaagaacttgccccccaaagtgcccata
acgccgatgccacagtattccattatggagacgccggtgctgaagaaggaactggatagg
tttggagtccgccctctgcctaaacgccagatggttctgaagctgaaggagatattccag
tacactcaccagaccctggactcagactccgaggacgagagccagtcctcacagccgctg
ttgcaggcgcctcactgccagaccctcgcctcccagacctacaagccttcaagggcaggg
gtccatgcccagcaggaggccaccacaggacctggggcccataggcccaagggacctgct
aagaccaagggcccccgacatcaaaggaagcatcatgaaagcatcacacccccaagcagg
tcgcccaccaaggaggcacctccaggcctcaatgatgacgcccagatcccagcctctcaa
gaatccgtggccacctctgtggatggcagtgacagctccttgagctcacagagttcttcc
tcctgtgagtttggagcggcatttgagtctgcaggtgaagaggagggcgagggggaggtc
agtgcctcgcaggcagccgtgcaggcggcggacacagacgaggcgctgaggtgctacatc
cgctccaagccggccctgtaccagaaggtgctgctgtaccagccctttgagctgcgggag
ctgcaggcagagctgaggcagaacggcctccgtgtgtcctcgcgcaggctgttggacttc
ctggacacccactgtatcaccttcaccactgccgccacccgcagggagaagctccagggc
aggaggcggcagcctcggggcaagaagaaggtggagcggaactga

DBGET integrated database retrieval system