KEGG   Homo sapiens (human): 84720Help
Entry
84720             CDS       T01001                                 

Gene name
PIGO, HPMRS2, RP11-182N22.4
Definition
phosphatidylinositol glycan anchor biosynthesis, class O
Orthology
K05288  
phosphatidylinositol glycan, class O
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:hsa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
9p13.3
AA seq 672 aa AA seqDB search
MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGA
CWMASRFSRVVLVLIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARL
YRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNLIKQLTSAGRRVVFMGDD
TWKDLFPGAFSKAFFFPSFNVRDLDTVDNGILEHLYPTMDSGEWDVLIAHFLGVDHCGHK
HGPHHPEMAKKLSQMDQVIQGLVERLENDTLLVVAGDHGMTTNGDHGGDSELEVSAALFL
YSPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIPFGNIGEVMAELFSGGEDSQPHSSA
LAQASALHLNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAEAT
LPTVIAELQQFLRGARAMCIESWARFSLSFLLLHLLAAGIPVTTPGPFTVPWQAVSAWAL
MATQTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLL
LLWPFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYL
FILGIQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVS
SWFRQLFLAQQR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagcctcagtgttgctcttcctggcctgggtctgcttcctcttctacgctggc
attgccctcttcaccagtggcttcctgctcacccgtttggagctcaccaaccatagcagc
tgccaagagcccccaggccctgggtccctgccatgggggagccaagggaaacctggggcc
tgctggatggcttcccgattttcgcgggttgtgttggtgctgatagatgctctgcgattt
gacttcgcccagccccagcattcacacgtgcctagagagcctcctgtctccctacccttc
ctgggcaaactaagctccttgcagaggatcctggagattcagccccaccatgcccggctc
taccgatctcaggttgaccctcctaccaccaccatgcagcgcctcaaggccctcaccact
ggctcactgcctacctttattgatgctggtagtaacttcgccagccacgccatagtggaa
gacaatctcattaagcagctcaccagtgcaggaaggcgtgtagtcttcatgggagatgat
acctggaaagaccttttccctggtgctttctccaaagctttcttcttcccatccttcaat
gtcagagacctagacacagtggacaatggcatcctggaacacctctaccccaccatggac
agtggtgaatgggacgtgctgattgctcacttcctgggtgtggaccactgtggccacaag
catggccctcaccaccctgaaatggccaagaaacttagccagatggaccaggtgatccag
ggacttgtggagcgtctggagaatgacacactgctggtagtggctggggaccatgggatg
accacaaatggagaccatggaggggacagtgagctggaggtctcagctgctctctttctg
tatagccccacagcagtcttccccagcaccccaccagaggagccagaggtgattcctcaa
gttagccttgtgcccacgctggccctgctgctgggcctgcccatcccatttgggaatatc
ggggaagtgatggctgagctattctcagggggtgaggactcccagccccactcctctgct
ttagcccaagcctcagctctccatctcaatgctcagcaggtgtcccgatttcttcatacc
tactcagctgctactcaggaccttcaagctaaggagcttcatcagctgcagaacctcttc
tccaaggcctctgctgactaccagtggcttctccagagccccaagggggctgaggcgaca
ctgccgactgtgattgctgagctgcagcagttcctgcggggagctcgggccatgtgcatc
gagtcttgggctcgtttctctctgagcttccttctcctacatctgcttgctgctgggata
cccgtcaccacccctggtccttttactgtgccatggcaggcagtctcggcttgggccctc
atggccacacagaccttctactccacaggccaccagcctgtctttccagccatccattgg
catgcagccttcgtgggattcccagagggtcatggctcctgtacttggctgcctgctttg
ctagtgggagccaacacctttgcctcccacctcctctttgcagtaggttgcccactgctc
ctgctctggcctttcctgtgtgagagtcaagggctgcggaagagacagcagcccccaggg
aatgaagctgatgccagagtcagacccgaggaggaagaggagccactgatggagatgcgg
ctccgggatgcgcctcagcacttctatgcagcactgctgcagctgggcctcaagtacctc
tttatccttggtattcagattctggcctgtgccttggcagcctccatccttcgcaggcat
ctcatggtctggaaagtgtttgcccctaagttcatatttgaggctgtgggcttcattgtg
agcagcgtgggacttctcctgggcatagctttggtgatgagagtggatggtgctgtgagc
tcctggttcaggcagctatttctggcccagcagaggtag

DBGET integrated database retrieval system