KEGG   Homo sapiens (human): 84790Help
Entry
84790             CDS       T01001                                 

Gene name
TUBA1C, TUBA6, bcm948
Definition
tubulin, alpha 1c
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q13.12
AA seq 449 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSADGEDEGEEY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgttggccaggctggtgtccagattggcaatgcctgc
tgggagctctactgcctggaacacggcatccagcccgatggccagatgccaagtgacaag
accattgggggaggagatgattccttcaacaccttcttcagtgaaacgggtgctggcaag
catgtgccccgggcagtgtttgtagacttggaacccacagtcattgatgaagttcgcact
ggcacttaccgccagctcttccaccctgagcaactcatcacaggcaaggaagatgctgcc
aataactatgcccgagggcactacaccattggcaaggagatcattgacctcgtgttggac
cgaattcgcaagctggctgaccagtgcaccggtcttcagggcttcttggttttccacagc
tttggtgggggaactggttctgggttcacctcgctgctcatggaacgtctctcagttgat
tatggcaagaagtccaagctggagttctccatttacccggcgccccaggtttccacagct
gtagttgagccctacaactccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgacatctgtcgtagaaacctcgatatcgag
cgcccaacctacactaaccttaaccgccttattagccagattgtgtcctccatcactgct
tccctgagatttgatggagccctgaatgttgacctgacagaattccagaccaacctggtg
ccctacccccgcatccacttccctctggccacatatgcccctgtcatctctgctgagaaa
gcctaccatgaacagcttactgtagcagagatcaccaatgcttgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgttataccgt
ggtgacgtggttcccaaagatgtcaatgctgccattgccaccatcaaaaccaagcgtacc
atccagtttgtggattggtgccccactggcttcaaggttggcattaattaccagcctccc
actgtggtgcctggcggagacctggccaaggtacagagagctgtgtgcatgctgagcaat
accacagctgttgccgaggcctgggctcgcctggaccacaagtttgacctgatgtatgcc
aagcgtgcctttgttcactggtacgtgggtgaggggatggaggaaggcgagttttcagag
gcccgtgaggacatggctgcccttgagaaggattatgaggaggttggagcagatagtgct
gacggagaggatgagggtgaagagtattaa

DBGET integrated database retrieval system