KEGG   Homo sapiens (human): 84790Help
Entry
84790             CDS       T01001                                 

Gene name
TUBA1C, TUBA6, bcm948
Definition
tubulin, alpha 1c
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    84790 (TUBA1C)
  Cellular commiunity
   04540 Gap junction
    84790 (TUBA1C)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    84790 (TUBA1C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   84790 (TUBA1C)
  Exosomal proteins of other body fluids (saliva and urine)
   84790 (TUBA1C)
  Exosomal proteins of colorectal cancer cells
   84790 (TUBA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q13.12
AA seq 449 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSADGEDEGEEY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgttggccaggctggtgtccagattggcaatgcctgc
tgggagctctactgcctggaacacggcatccagcccgatggccagatgccaagtgacaag
accattgggggaggagatgattccttcaacaccttcttcagtgaaacgggtgctggcaag
catgtgccccgggcagtgtttgtagacttggaacccacagtcattgatgaagttcgcact
ggcacttaccgccagctcttccaccctgagcaactcatcacaggcaaggaagatgctgcc
aataactatgcccgagggcactacaccattggcaaggagatcattgacctcgtgttggac
cgaattcgcaagctggctgaccagtgcaccggtcttcagggcttcttggttttccacagc
tttggtgggggaactggttctgggttcacctcgctgctcatggaacgtctctcagttgat
tatggcaagaagtccaagctggagttctccatttacccggcgccccaggtttccacagct
gtagttgagccctacaactccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgacatctgtcgtagaaacctcgatatcgag
cgcccaacctacactaaccttaaccgccttattagccagattgtgtcctccatcactgct
tccctgagatttgatggagccctgaatgttgacctgacagaattccagaccaacctggtg
ccctacccccgcatccacttccctctggccacatatgcccctgtcatctctgctgagaaa
gcctaccatgaacagcttactgtagcagagatcaccaatgcttgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgttataccgt
ggtgacgtggttcccaaagatgtcaatgctgccattgccaccatcaaaaccaagcgtacc
atccagtttgtggattggtgccccactggcttcaaggttggcattaattaccagcctccc
actgtggtgcctggcggagacctggccaaggtacagagagctgtgtgcatgctgagcaat
accacagctgttgccgaggcctgggctcgcctggaccacaagtttgacctgatgtatgcc
aagcgtgcctttgttcactggtacgtgggtgaggggatggaggaaggcgagttttcagag
gcccgtgaggacatggctgcccttgagaaggattatgaggaggttggagcagatagtgct
gacggagaggatgagggtgaagagtattaa

DBGET integrated database retrieval system