KEGG   Homo sapiens (human): 8517Help
Entry
8517              CDS       T01001                                 

Gene name
IKBKG, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9
Definition
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
Orthology
K07210  
inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Primary immunodeficiency
Module
Toll-like receptor signaling
Disease
H00095  
Ectodermal dysplasia associated immunodeficiency (EDA-ID)
H00540  
Osteoporosis, lymphedema, anhydrotic ectodermal dysplasia with immunodeficiency (OLEDAID)
H00645  
Incontinentia pigmenti
H01245  
Immunodeficiency without anhidrotic ectodermal  dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8517 (IKBKG)
   04010 MAPK signaling pathway
    8517 (IKBKG)
   04064 NF-kappa B signaling pathway
    8517 (IKBKG)
   04668 TNF signaling pathway
    8517 (IKBKG)
   04151 PI3K-Akt signaling pathway
    8517 (IKBKG)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8517 (IKBKG)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    8517 (IKBKG)
   04621 NOD-like receptor signaling pathway
    8517 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    8517 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    8517 (IKBKG)
   04660 T cell receptor signaling pathway
    8517 (IKBKG)
   04662 B cell receptor signaling pathway
    8517 (IKBKG)
   04062 Chemokine signaling pathway
    8517 (IKBKG)
  Endocrine system
   04920 Adipocytokine signaling pathway
    8517 (IKBKG)
  Development
   04380 Osteoclast differentiation
    8517 (IKBKG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8517 (IKBKG)
   05203 Viral carcinogenesis
    8517 (IKBKG)
   05212 Pancreatic cancer
    8517 (IKBKG)
   05221 Acute myeloid leukemia
    8517 (IKBKG)
   05220 Chronic myeloid leukemia
    8517 (IKBKG)
   05215 Prostate cancer
    8517 (IKBKG)
   05222 Small cell lung cancer
    8517 (IKBKG)
  Immune diseases
   05340 Primary immunodeficiency
    8517 (IKBKG)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    8517 (IKBKG)
   05131 Shigellosis
    8517 (IKBKG)
   05166 HTLV-I infection
    8517 (IKBKG)
   05161 Hepatitis B
    8517 (IKBKG)
   05160 Hepatitis C
    8517 (IKBKG)
   05168 Herpes simplex infection
    8517 (IKBKG)
   05169 Epstein-Barr virus infection
    8517 (IKBKG)
   05145 Toxoplasmosis
    8517 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    8517 (IKBKG)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   8517 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xq28
AA seq 487 aa AA seqDB search
MALVIQVGKLRPREVRTPQTINPSLFPSLPVKLSSIIEVPSGGERCCSRRTLVYKARAFW
KGAPLPCWMNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQ
RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL
DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG
RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV
AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK
IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR
IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQI
HVMECIE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgtgatccaggtggggaaactaaggcccagagaagtgaggaccccgcagact
atcaatcccagtctcttcccctcactccctgtgaagctctccagcatcatcgaggtccca
tcaggtggggaaagatgctgttccaggcgcacactagtctacaaggccagagctttctgg
aagggggcacccttgccctgttggatgaataggcacctctggaagagccaactgtgtgag
atggtgcagcccagtggtggcccggcagcagatcaggacgtactgggcgaagagtctcct
ctggggaagccagccatgctgcacctgccttcagaacagggcgctcctgagaccctccag
cgctgcctggaggagaatcaagagctccgagatgccatccggcagagcaaccagattctg
cgggagcgctgcgaggagcttctgcatttccaagccagccagagggaggagaaggagttc
ctcatgtgcaagttccaggaggccaggaaactggtggagagactcggcctggagaagctc
gatctgaagaggcagaaggagcaggctctgcgggaggtggagcacctgaagagatgccag
cagcagatggctgaggacaaggcctctgtgaaagcccaggtgacgtccttgctcggggag
ctgcaggagagccagagtcgcttggaggctgccactaaggaatgccaggctctggagggt
cgggcccgggcggccagcgagcaggcgcggcagctggagagtgagcgcgaggcgctgcag
cagcagcacagcgtgcaggtggaccagctgcgcatgcagggccagagcgtggaggccgcg
ctccgcatggagcgccaggccgcctcggaggagaagaggaagctggcccagttgcaggtg
gcctatcaccagctcttccaagaatacgacaaccacatcaagagcagcgtggtgggcagt
gagcggaagcgaggaatgcagctggaagatctcaaacagcagctccagcaggccgaggag
gccctggtggccaaacaggaggtgatcgataagctgaaggaggaggccgagcagcacaag
attgtgatggagaccgttccggtgctgaaggcccaggcggatatctacaaggcggacttc
caggctgagaggcaggcccgggagaagctggccgagaagaaggagctcctgcaggagcag
ctggagcagctgcagagggagtacagcaaactgaaggccagctgtcaggagtcggccagg
atcgaggacatgaggaagcggcatgtcgaggtctcccaggcccccttgccccccgcccct
gcctacctctcctctcccctggccctgcccagccagaggaggagcccccccgaggagcca
cctgacttctgctgtcccaagtgccagtatcaggcccctgatatggacaccctgcagata
catgtcatggagtgcattgagtag

DBGET integrated database retrieval system