KEGG   Homo sapiens (human): 859Help
Entry
859               CDS       T01001                                 

Gene name
CAV3, LGMD1C, LQT9, VIP-21, VIP21
Definition
caveolin 3
Orthology
K12959  
caveolin 3
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Disease
H00567  
Caveolinopathies
H00593  
Limb-girdle muscular dystrophy (LGMD)
H00720  
Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    859 (CAV3)
  Cellular commiunity
   04510 Focal adhesion
    859 (CAV3)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    859 (CAV3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    859 (CAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
3p25
AA seq 151 aa AA seqDB search
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatggcagaagagcacacagatctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaagaacattaacgaggacatagtcaaggtggat
tttgaagacgtgatcgcagagcctgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcactgtctccaagtactggtgctaccgtctgttgtccacgctgctg
ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccatgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system