KEGG   Homo sapiens (human): 860Help
Entry
860               CDS       T01001                                 

Gene name
RUNX2, AML3, CBF-alpha-1, CBFA1, CCD, CCD1, CLCD, OSF-2, OSF2, PEA2aA, PEBP2aA
Definition
runt-related transcription factor 2
Orthology
K09278  
runt-related transcription factor 2
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00521  
Cleidocranial dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    860 (RUNX2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    860 (RUNX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
6p21
AA seq 499 aa AA seqDB search
MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQ
QQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPN
FLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVA
RFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPS
LFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYD
QSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSL
TESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSST
PYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSS
SPTVLNSSGRMDESVWRPY
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaacagcctcttcagcacagtgacaccatgtcagcaaaacttcttttgggat
ccgagcaccagccggcgcttcagccccccctccagcagcctgcagcccggcaaaatgagc
gacgtgagcccggtggtggctgcgcaacagcagcagcaacagcagcagcagcaacagcag
cagcagcagcagcaacagcagcagcagcagcaggaggcggcggcggcggctgcggcggcg
gcggcggctgcggcggcggcagctgcagtgccccggttgcggccgccccacgacaaccgc
accatggtggagatcatcgccgaccacccggccgaactcgtccgcaccgacagccccaac
ttcctgtgctcggtgctgccctcgcactggcgctgcaacaagaccctgcccgtggccttc
aaggtggtagccctcggagaggtaccagatgggactgtggttactgtcatggcgggtaac
gatgaaaattattctgctgagctccggaatgcctctgctgttatgaaaaaccaagtagca
aggttcaacgatctgagatttgtgggccggagtggacgaggcaagagtttcaccttgacc
ataaccgtcttcacaaatcctccccaagtagctacctatcacagagcaattaaagttaca
gtagatggacctcgggaacccagaaggcacagacagaagcttgatgactctaaacctagt
ttgttctctgaccgcctcagtgatttagggcgcattcctcatcccagtatgagagtaggt
gtcccgcctcagaacccacggccctccctgaactctgcaccaagtccttttaatccacaa
ggacagagtcagattacagaccccaggcaggcacagtcttccccgccgtggtcctatgac
cagtcttacccctcctacctgagccagatgacgtccccgtccatccactctaccaccccg
ctgtcttccacacggggcactgggcttcctgccatcaccgatgtgcctaggcgcatttca
ggtgcttcagaactgggccctttttcagaccccaggcagttcccaagcatttcatccctc
actgagagccgcttctccaacccacgaatgcactatccagccacctttacttacaccccg
ccagtcacctcaggcatgtccctcggtatgtccgccaccactcactaccacacctacctg
ccaccaccctaccccggctcttcccaaagccagagtggacccttccagaccagcagcact
ccatatctctactatggcacttcgtcaggatcctatcagtttcccatggtgccgggggga
gaccggtctccttccagaatgcttccgccatgcaccaccacctcgaatggcagcacgcta
ttaaatccaaatttgcctaaccagaatgatggtgttgacgctgatggaagccacagcagt
tccccaactgttttgaattctagtggcagaatggatgaatctgtttggcgaccatattga

DBGET integrated database retrieval system