KEGG   Homo sapiens (human): 8626Help
Entry
8626              CDS       T01001                                 

Gene name
TP63, AIS, B(p51A), B(p51B), EEC3, KET, LMS, NBP, OFC8, RHS, SHFM4, TP53CP, TP53L, TP73L, p40, p51, p53CP, p63, p73H, p73L
Definition
tumor protein p63
Orthology
K10149  
tumor protein p63
Organism
hsa  Homo sapiens (human)
Pathway
MicroRNAs in cancer
Disease
H00471  
Split-hand/foot malformation (SHFM)
H00516  
Isolated orofacial clefts
H00638  
Ectrodactyly-ectodermal dysplasia cleft-palate syndrome (EEC syndrome)
H00640  
Limb-mammary syndrome
H00641  
ADULT syndrome
H00752  
Ankyloblepharon-ctodermal defects-cleft lip/palate (AEC) syndrome and Rapp-Hodgkin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    8626 (TP63)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    8626 (TP63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3q28
AA seq 555 aa AA seqDB search
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVRIWQV
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacttcacggtgtgccaccctacagtactgccctgacccttacatccag
cgtttcgtagaaaccccagctcatttctcttggaaagaaagttattaccgatccaccatg
tcccagagcacacagacaaatgaattcctcagtccagaggttttccagcatatctgggat
tttctggaacagcctatatgttcagttcagcccattgacttgaactttgtggatgaacca
tcagaagatggtgcgacaaacaagattgagattagcatggactgtatccgcatgcaggac
tcggacctgagtgaccccatgtggccacagtacacgaacctggggctcctgaacagcatg
gaccagcagattcagaacggctcctcgtccaccagtccctataacacagaccacgcgcag
aacagcgtcacggcgccctcgccctacgcacagcccagctccaccttcgatgctctctct
ccatcacccgccatcccctccaacaccgactacccaggcccgcacagtttcgacgtgtcc
ttccagcagtcgagcaccgccaagtcggccacctggacgtattccactgaactgaagaaa
ctctactgccaaattgcaaagacatgccccatccagatcaaggtgatgaccccacctcct
cagggagctgttatccgcgccatgcctgtctacaaaaaagctgagcacgtcacggaggtg
gtgaagcggtgccccaaccatgagctgagccgtgaattcaacgagggacagattgcccct
cctagtcatttgattcgagtagaggggaacagccatgcccagtatgtagaagatcccatc
acaggaagacagagtgtgctggtaccttatgagccaccccaggttggcactgaattcacg
acagtcttgtacaatttcatgtgtaacagcagttgtgttggagggatgaaccgccgtcca
attttaatcattgttactctggaaaccagagatgggcaagtcctgggccgacgctgcttt
gaggcccggatctgtgcttgcccaggaagagacaggaaggcggatgaagatagcatcaga
aagcagcaagtttcggacagtacaaagaacggtgatggtacgaagcgcccgtttcgtcag
aacacacatggtatccagatgacatccatcaagaaacgaagatccccagatgatgaactg
ttatacttaccagtgaggggccgtgagacttatgaaatgctgttgaagatcaaagagtcc
ctggaactcatgcagtaccttcctcagcacacaattgaaacgtacaggcaacagcaacag
cagcagcaccagcacttacttcagaaacagacctcaatacagtctccatcttcatatggt
aacagctccccacctctgaacaaaatgaacagcatgaacaagctgccttctgtgagccag
cttatcaaccctcagcagcgcaacgccctcactcctacaaccattcctgatggcatggga
gccaacattcccatgatgggcacccacatgccaatggctggagacatgaatggactcagc
cccacccaggcactccctcccccactctccatgccatccacctcccactgcacaccccca
cctccgtatcccacagattgcagcattgtcaggatctggcaagtctga

DBGET integrated database retrieval system