KEGG   Homo sapiens (human): 8647Help
Entry
8647              CDS       T01001                                 

Gene name
ABCB11, ABC16, BRIC2, BSEP, PFIC-2, PFIC2, PGY4, SPGP
Definition
ATP-binding cassette, sub-family B (MDR/TAP), member 11
Orthology
K05664  
ATP-binding cassette, subfamily B (MDR/TAP), member 11
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Bile secretion
Disease
H00624  
Familial cholestasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    8647 (ABCB11)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    8647 (ABCB11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8647 (ABCB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2q24
AA seq 1321 aa AA seqDB search
MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIW
LMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLN
QNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFR
RIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFRGWK
LTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE
VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLV
QIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEI
EFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVT
VDGHDIRSLNIQWLRDQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNF
IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV
LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQG
NQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST
YEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQIL
GTFSIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAML
GQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL
SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFI
EALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASYRYGGYLISNEGLHFSYVFRV
ISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDF
VDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMID
GHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF
VMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVA
LDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVTTGSPI
S
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactcagtaattcttcgaagtataaagaaatttggagaggagaatgatggtttt
gagtcagataaatcatataataatgataagaaatcaaggttacaagatgagaagaaaggt
gatggcgttagagttggcttctttcaattgtttcggttttcttcatcaactgacatttgg
ctgatgtttgtgggaagtttgtgtgcatttctccatggaatagcccagccaggcgtgcta
ctcatttttggcacaatgacagatgtttttattgactacgacgttgagttacaagaactc
cagattccaggaaaagcatgtgtgaataacaccattgtatggactaacagttccctcaac
cagaacatgacaaatggaacacgttgtgggttgctgaacatcgagagcgaaatgatcaaa
tttgccagttactatgctggaattgctgtcgcagtacttatcacaggatatattcaaata
tgcttttgggtcattgccgcagctcgtcagatacagaaaatgagaaaattttactttagg
agaataatgagaatggaaatagggtggtttgactgcaattcagtgggggagctgaataca
agattctctgatgatattaataaaatcaatgatgccatagctgaccaaatggcccttttc
attcagcgcatgacctcgaccatctgtggtttcctgttgggatttttcaggggttggaaa
ctgaccttggttattatttctgtcagccctctcattgggattggagcagccaccattggt
ctgagtgtgtccaagtttacggactatgagctgaaggcctatgccaaagcaggggtggtg
gctgatgaagtcatttcatcaatgagaacagtggctgcttttggtggtgagaaaagagag
gttgaaaggtatgagaaaaatcttgtgttcgcccagcgttggggaattagaaaaggaata
gtgatgggattctttactggattcgtgtggtgtctcatctttttgtgttatgcactggcc
ttctggtacggctccacacttgtcctggatgaaggagaatatacaccaggaacccttgtc
cagattttcctcagtgtcatagtaggagctttaaatcttggcaatgcctctccttgtttg
gaagcctttgcaactggacgtgcagcagccaccagcatttttgagacaatagacaggaaa
cccatcattgactgcatgtcagaagatggttacaagttggatcgaatcaagggtgaaatt
gaattccataatgtgaccttccattatccttccagaccagaggtgaagattctaaatgac
ctcaacatggtcattaaaccaggggaaatgacagctctggtaggacccagtggagctgga
aaaagtacagcactgcaactcattcagcgattctatgacccctgtgaaggaatggtgacc
gtggatggccatgacattcgctctcttaacattcagtggcttagagatcagattgggata
gtggagcaagagccagttctgttctctaccaccattgcagaaaatattcgctatggcaga
gaagatgcaacaatggaagacatagtccaagctgccaaggaggccaatgcctacaacttc
atcatggacctgccacagcaatttgacacccttgttggagaaggaggaggccagatgagt
ggtggccagaaacaaagggtagctatcgccagagccctcatccgaaatcccaagattctg
cttttggacatggccacctcagctctggacaatgagagtgaagccatggtgcaagaagtg
ctgagtaagattcagcatgggcacacaatcatttcagttgctcatcgcttgtctacggtc
agagctgcagataccatcattggttttgaacatggcactgcagtggaaagagggacccat
gaagaattactggaaaggaaaggtgtttacttcactctagtgactttgcaaagccaggga
aatcaagctcttaatgaagaggacataaaggatgcaactgaagatgacatgcttgcgagg
acctttagcagagggagctaccaggatagtttaagggcttccatccggcaacgctccaag
tctcagctttcttacctggtgcacgaacctccattagctgttgtagatcataagtctacc
tatgaagaagatagaaaggacaaggacattcctgtgcaggaagaagttgaacctgcccca
gttaggaggattctgaaattcagtgctccagaatggccctacatgctggtagggtctgtg
ggtgcagctgtgaacgggacagtcacacccttgtatgcctttttattcagccagattctt
gggactttttcaattcctgataaagaggaacaaaggtcacagatcaatggtgtgtgccta
ctttttgtagcaatgggctgtgtatctcttttcacccaatttctacagggatatgccttt
gctaaatctggggagctcctaacaaaaaggctacgtaaatttggtttcagggcaatgctg
gggcaagatattgcctggtttgatgacctcagaaatagccctggagcattgacaacaaga
cttgctacagatgcttcccaagttcaaggggctgccggctctcagatcgggatgatagtc
aattccttcactaacgtcactgtggccatgatcattgccttctcctttagctggaagctg
agcctggtcatcttgtgcttcttccccttcttggctttatcaggagccacacagaccagg
atgttgacaggatttgcctctcgagataagcaggccctggagatggtgggacagattaca
aatgaagccctcagtaacatccgcactgttgctggaattggaaaggagaggcggttcatt
gaagcacttgagactgagctggagaagcccttcaagacagccattcagaaagccaatatt
tacggattctgctttgcctttgcccagtgcatcatgtttattgcgaattctgcttcctac
agatatggaggttacttaatctccaatgaggggctccatttcagctatgtgttcagggtg
atctctgcagttgtactgagtgcaacagctcttggaagagccttctcttacaccccaagt
tatgcaaaagctaaaatatcagctgcacgcttttttcaactgctggaccgacaaccccca
atcagtgtatacaatactgcaggtgaaaaatgggacaacttccaggggaagattgatttt
gttgattgtaaatttacatatccttctcgacctgactcgcaagttctgaatggtctctca
gtgtcgattagtccagggcagacactggcgtttgttgggagcagtggatgtggcaaaagc
actagcattcagctgttggaacgtttctatgatcctgatcaagggaaggtgatgatagat
ggtcatgacagcaaaaaagtaaatgtccagttcctccgctcaaacattggaattgtttcc
caggaaccagtgttgtttgcctgtagcataatggacaatatcaagtatggagacaacacc
aaagaaattcccatggaaagagtcatagcagctgcaaaacaggctcagctgcatgatttt
gtcatgtcactcccagagaaatatgaaactaacgttgggtcccaggggtctcaactctct
agaggggagaaacaacgcattgctattgctcgggccattgtacgagatcctaaaatcttg
ctactagatgaagccacttctgccttagacacagaaagtgaaaagacggtgcaggttgct
ctagacaaagccagagagggtcggacctgcattgtcattgcccatcgcttgtccaccatc
cagaacgcggatatcattgctgtcatggcacagggggtggtgattgaaaaggggacccat
gaagaactgatggcccaaaaaggagcctactacaaactagtcaccactggatcccccatc
agttga

DBGET integrated database retrieval system