KEGG   Homo sapiens (human): 8666Help
Entry
8666              CDS       T01001                                 

Gene name
EIF3G, EIF3-P42, EIF3S4, eIF3-delta, eIF3-p44
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit G
  KO
K03248  translation initiation factor 3 subunit G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8666 (EIF3G)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    8666 (EIF3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3g RRM_1 CDV3 RRM_occluded RNA_bind Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 8666
NCBI-ProteinID: NP_003746
OMIM: 603913
HGNC: 3274
Ensembl: ENSG00000130811
Vega: OTTHUMG00000180396
Pharos: O75821(Tbio)
UniProt: O75821
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 320 aa AA seqDB search
MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVI
NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATT
TVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQK
ELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNAT
IRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGV
SGFGYDHLILNVEWAKPSTN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctactggagactttgattcgaagcccagttgggccgaccaggtggaggaggagggg
gaggacgacaaatgtgtcaccagcgagctcctcaaggggatccctctggccacaggtgac
accagcccagagccagagctactgccgggagctccactgccgcctcccaaggaggtcatc
aacggaaacataaagacagtgacagagtacaagatagatgaggatggcaagaagttcaag
attgtccgcaccttcaggattgagacccggaaggcttcaaaggctgtcgcaaggaggaag
aactggaagaagttcgggaactcagagtttgacccccccggacccaatgtggccaccacc
actgtcagtgacgatgtctctatgacgttcatcaccagcaaagaggacctgaactgccag
gaggaggaggaccctatgaacaaactcaagggccagaagatcgtgtcctgccgcatctgc
aagggcgaccactggaccacccgctgcccctacaaggatacgctggggcccatgcagaag
gagctggccgagcagctgggcctgtctactggcgagaaggagaagctgccgggagagcta
gagccggtgcaggccacgcagaacaagacagggaagtatgtgccgccgagcctgcgcgac
ggggccagccgccgcggggagtccatgcagcccaaccgcagagccgacgacaacgccacc
atccgtgtcaccaacttgtcagaggacacgcgtgagaccgacctgcaggagctcttccgg
cctttcggctccatctcccgcatctacctggctaaggacaagaccactggccaatccaag
ggctttgccttcatcagcttccaccgccgcgaggatgctgcgcgtgccattgccggggtg
tccggctttggctacgaccacctcatcctcaacgtcgagtgggccaagccgtccaccaac
taa

DBGET integrated database retrieval system