KEGG   Homo sapiens (human): 8666Help
Entry
8666              CDS       T01001                                 

Gene name
EIF3G, EIF3-P42, EIF3S4, eIF3-delta, eIF3-p44
Definition
eukaryotic translation initiation factor 3, subunit G
Orthology
K03248  
translation initiation factor 3 subunit G
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 320 aa AA seqDB search
MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVI
NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATT
TVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQK
ELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNAT
IRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGV
SGFGYDHLILNVEWAKPSTN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctactggagactttgattcgaagcccagttgggccgaccaggtggaggaggagggg
gaggacgacaaatgtgtcaccagcgagctcctcaaggggatccctctggccacaggtgac
accagcccagagccagagctactgccgggagctccactgccgcctcccaaggaggtcatc
aacggaaacataaagacagtgacagagtacaagatagatgaggatggcaagaagttcaag
attgtccgcaccttcaggattgagacccggaaggcttcaaaggctgtcgcaaggaggaag
aactggaagaagttcgggaactcagagtttgacccccccggacccaatgtggccaccacc
actgtcagtgacgatgtctctatgacgttcatcaccagcaaagaggacctgaactgccag
gaggaggaggaccctatgaacaaactcaagggccagaagatcgtgtcctgccgcatctgc
aagggcgaccactggaccacccgctgcccctacaaggatacgctggggcccatgcagaag
gagctggccgagcagctgggcctgtctactggcgagaaggagaagctgccgggagagcta
gagccggtgcaggccacgcagaacaagacagggaagtatgtgccgccgagcctgcgcgac
ggggccagccgccgcggggagtccatgcagcccaaccgcagagccgacgacaacgccacc
atccgtgtcaccaacttgtcagaggacacgcgtgagaccgacctgcaggagctcttccgg
cctttcggctccatctcccgcatctacctggctaaggacaagaccactggccaatccaag
ggctttgccttcatcagcttccaccgccgcgaggatgctgcgcgtgccattgccggggtg
tccggctttggctacgaccacctcatcctcaacgtcgagtgggccaagccgtccaccaac
taa

DBGET integrated database retrieval system