KEGG   Homo sapiens (human): 8675Help
Entry
8675              CDS       T01001                                 

Gene name
STX16, SYN16
Definition
syntaxin 16
Orthology
K08489  
syntaxin 16
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Disease
H00244  
Pseudohypoparathyroidism
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
20q13.32
AA seq 325 aa AA seqDB search
MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGI
SLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEH
AIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQ
SGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREI
RQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNR
KMLVILILFVIIIVLIVVLVGVKSR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaggcgtttaaccgacgctttcttgttgttgcggaataattccatccaaaac
cggcagctgttagccgagcaagtgagtagtcacatcacctccagccctctgcattcacgt
agcattgctgcggagctggacgagcttgctgatgaccgtatggcactggtgtcaggcatc
agcttagatccagaagcagcgattggtgtgacaaaacggccacctcctaagtgggtggat
ggagtggatgaaattcagtatgatgttggccggattaagcagaagatgaaagaattggcc
agccttcatgacaagcatttaaacagacccaccctggatgacagcagcgaagaggaacat
gccattgagataactacccaagagatcactcagctcttccacaggtgccagcgtgccgtg
caggccctgccgagccgggcccgggcctgctccgagcaggaggggcggctgcttgggaac
gtggtggcctcgctggcgcaggccctgcaggaactctccaccagcttccggcacgcacag
tcaggctacctcaaacgcatgaagaatcgagaggaaagatcccagcattttttcgacaca
tcagtaccactaatggatgatggagacgataacactctttaccatcggggttttacagag
gaccagttagttctggtggagcagaacacactgatggtggaagagcgggaacgagagatt
cgccagattgtacagtccatttctgacctgaatgaaatattcagggacttaggggcgatg
attgtagaacagggtacagtccttgacagaattgactataacgttgaacagtcctgtatc
aaaactgaagatggtttgaaacagcttcacaaggcagaacagtatcaaaagaagaatcgg
aagatgcttgtgattttaatattatttgtcatcatcattgtgctcattgttgtcctcgtt
ggcgtgaagtctcgataa

DBGET integrated database retrieval system