KEGG   Homo sapiens (human): 8813Help
Entry
8813              CDS       T01001                                 

Gene name
DPM1, CDGIE, MPDS
Definition
dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8813 (DPM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     8813 (DPM1)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   8813 (DPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
20q13.13
AA seq 260 aa AA seqDB search
MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEI
IIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDAD
LSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGA
SDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESK
LGGNEIVSFLKGLLTLFATT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttggaagtcagtcgtagtcctcgcaggtctcggcgggagctggaagtgcgc
agtccacgacagaacaaatattcggtgcttttacctacctacaacgagcgcgagaacctg
ccgctcatcgtgtggctgctggtgaaaagcttctccgagagtggaatcaactatgaaatt
ataatcatagatgatggaagcccagatggaacaagggatgttgctgaacagttggagaag
atctatgggtcagacagaattcttctaagaccacgagagaaaaagttgggactaggaact
gcatatattcatggaatgaaacatgccacaggaaactacatcattattatggatgctgat
ctctcacaccatccaaaatttattcctgaatttattaggaagcaaaaggagggtaatttt
gatattgtctctggaactcgctacaaaggaaatggaggtgtatatggctgggatttgaaa
agaaaaataatcagccgtggggccaattttttaactcagatcttgctgagaccaggagca
tctgatttaacaggaagtttcagattataccgaaaagaagttctagagaaattaatagaa
aaatgtgtttctaaaggctacgtcttccagatggagatgattgttcgggcaagacagttg
aattatactattggcgaggttccaatatcatttgtggatcgtgtttatggtgaatccaag
ttgggaggaaatgaaatagtatctttcttgaaaggattattgactctttttgctactaca
taa

DBGET integrated database retrieval system