KEGG   Homo sapiens (human): 91869Help
Entry
91869             CDS       T01001                                 

Gene name
RFT1, CDG1N
Definition
RFT1 homolog (S. cerevisiae)
Orthology
K06316  
oligosaccharidyl-lipid flippase family
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
3p21.1
AA seq 541 aa AA seqDB search
MGSQEVLGHAARLASSGLLLQVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLF
LAREAFRRACLSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYA
TGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLY
IFSLAQLFYTTVLVLCYVIYFTKLLGSPESTKLQTLPVSRITDLLPNITRNGAFINWKEA
KLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESF
YIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAYSQLALDIYGG
TMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSY
LLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLSPVLLGTFALSGG
VTAVSEVFLCCEQGWPARLAHIAVGAFCLGATLGTAFLTETKLIHFLRTQLGVPRRTDKM
T
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccaggaggtgctgggccacgcggcccggctggcctcctccggtctcctcctg
caggtgttgtttcggttgatcacctttgtcttgaatgcatttattcttcgcttcctgtca
aaggaaatcgttggcgtagtaaatgtaagactaacgctgctttactcaaccaccctcttc
ctggccagagaggccttccgcagagcatgtctcagtgggggcacccagcgagactggagc
cagaccctcaacctgctgtggctaacagtccccctgggtgtgttttggtccttattcctg
ggctggatctggttgcagctgcttgaagtgcctgatcctaatgttgtccctcactatgca
actggagtggtgctgtttggtctctcggcagtggtggagcttctaggagagcccttttgg
gtcttggcacaagcacatatgtttgtgaagctcaaggtgattgcagagagcctgtcggta
attcttaagagcgttctgacagcttttctcgtgctgtggttgcctcactggggattgtac
attttctctttggcccagcttttctataccacagttctggtgctctgctatgttatttat
ttcacaaagttactgggttccccagaatcaaccaagcttcaaactcttcctgtctccaga
ataacagatctgttacccaatattacaagaaatggagcgtttataaactggaaagaggct
aaactgacttggagttttttcaaacagtctttcttgaaacagattttgacagaaggcgag
cgatatgtgatgacatttttgaatgtattgaactttggtgatcagggtgtgtatgatata
gtgaataatcttggctcccttgtggccagattaattttccagccaatagaggaaagtttt
tatatattttttgctaaggtgctggagaggggaaaggatgccacacttcagaagcaggag
gacgttgctgtggctgctgcagtcttggagtccctgctcaagctggccctgctggccggc
ctgaccatcactgtttttggctttgcctattctcagctggctctggatatctacggaggg
accatgcttagctcaggatccggtcctgttttgctgcgttcctactgtctctatgttctc
ctgcttgccatcaatggagtgacagagtgtttcacatttgctgccatgagcaaagaggag
gtcgacaggtacaattttgtgatgctggccctgtcctcctcattcctggtgttatcctat
ctcttgacccgttggtgtggcagcgtgggcttcatcttggccaactgctttaacatgggc
attcggatcacgcagagcctttgcttcatccaccgctactaccgaaggagcccccacagg
cccctggctggcctgcacctatcgccagtcctgctcgggacatttgccctcagtggtggg
gttactgctgtttcggaggtattcctctgctgtgagcagggctggccagccagactggca
cacattgctgtgggggccttctgtctgggagcaactctcgggacagcattcctcacagag
accaagctgatccatttcctcaggactcagttaggtgtgcccagacgcactgacaaaatg
acatga

DBGET integrated database retrieval system