KEGG   Homo sapiens (human): 9241Help
Entry
9241              CDS       T01001                                 

Gene name
NOG, SYM1, SYNS1
Definition
noggin
Orthology
K04658  
noggin
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Disease
H00482  
Brachydactyly
H00484  
Other brachydactylies
H00778  
Tarsal-carpal coalition syndrome
H00868  
Stapes ankylosis with broad thumb and toes
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q22
AA seq 232 aa AA seqDB search
MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD
LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS
KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctgccccagcctaggggtcaccctctacgccctggtggtggtcctggggctg
cgggcgacaccggccggcggccagcactatctccacatccgcccggcacccagcgacaac
ctgcccctggtggacctcatcgaacacccagaccctatctttgaccccaaggaaaaggat
ctgaacgagacgctgctgcgctcgctgctcgggggccactacgacccaggcttcatggcc
acctcgccccccgaggaccggcccggcgggggcgggggtgcagctgggggcgcggaggac
ctggcggagctggaccagctgctgcggcagcggccgtcgggggccatgccgagcgagatc
aaagggctagagttctccgagggcttggcccagggcaagaagcagcgcctaagcaagaag
ctgcggaggaagttacagatgtggctgtggtcgcagacattctgccccgtgctgtacgcg
tggaacgacctgggcagccgcttttggccgcgctacgtgaaggtgggcagctgcttcagt
aagcgctcgtgctccgtgcccgagggcatggtgtgcaagccgtccaagtccgtgcacctc
acggtgctgcggtggcgctgtcagcggcgcgggggccagcgctgcggctggattcccatc
cagtaccccatcatttccgagtgcaagtgctcgtgctag

DBGET integrated database retrieval system