KEGG   Homo sapiens (human): 9380Help
Entry
9380              CDS       T01001                                 

Gene name
GRHPR, GLXR, GLYD, PH2
Definition
glyoxylate reductase/hydroxypyruvate reductase (EC:1.1.1.79 1.1.1.81)
Orthology
K00049  
glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Disease
H00117  
Primary hyperoxaluria (HP)
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hsa00630]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q12
AA seq 328 aa AA seqDB search
MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLS
DHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLL
TTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRF
LYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVF
INISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHR
TRNTMSLLAANNLLAGLRGEPMPSELKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagaccggtgcgactcatgaaggtgttcgtcacccgcaggatacccgccgagggtagg
gtcgcgctcgcccgggcggcagactgtgaggtggagcagtgggactcggatgagcccatc
cctgccaaggagctagagcgaggtgtggcgggggcccacggcctgctctgcctcctctcc
gaccacgtggacaagaggatcctggatgctgcaggggccaatctcaaagtcatcagcacc
atgtctgtgggcatcgaccacttggctttggatgaaatcaagaagcgtgggatccgagtt
ggctacaccccagatgtcctgacagataccaccgccgaactcgcagtctccctgctactt
accacctgccgccggttgccggaggccatcgaggaagtgaagaatggtggctggacctcg
tggaagcccctctggctgtgtggctatggactcacgcagagcactgtcggcatcatcggg
ctggggcgcataggccaggccattgctcggcgtctgaaaccattcggtgtccagagattt
ctgtacacagggcgccagcccaggcctgaggaagcagcagaattccaggcagagtttgtg
tctacccctgagctggctgcccaatctgatttcatcgtcgtggcctgctccttaacacct
gcaaccgagggactctgcaacaaggacttcttccagaagatgaaggaaacagctgtgttc
atcaacatcagcaggggcgacgtcgtaaaccaggacgacctgtaccaggccttggccagt
ggtaagattgcagctgctggactggatgtgacgagcccagaaccactgcctacaaaccac
cctctcctgaccctgaagaactgtgtgattctgccccacattggcagtgccacccacaga
acccgcaacaccatgtccttgttggcagctaacaacttgctggctggcctgagaggggag
ccgatgcctagtgaactcaagctgtag

DBGET integrated database retrieval system