KEGG   Homo sapiens (human): 9380Help
Entry
9380              CDS       T01001                                 

Gene name
GRHPR, GLXR, GLYD, PH2
Definition
glyoxylate reductase/hydroxypyruvate reductase (EC:1.1.1.79 1.1.1.81)
Orthology
K00049  
glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Disease
H00117  
Primary hyperoxaluria (HP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    9380 (GRHPR)
   00630 Glyoxylate and dicarboxylate metabolism
    9380 (GRHPR)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    9380 (GRHPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     9380 (GRHPR)
    1.1.1.81  hydroxypyruvate reductase
     9380 (GRHPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q12
AA seq 328 aa AA seqDB search
MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLS
DHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLL
TTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRF
LYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVF
INISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHR
TRNTMSLLAANNLLAGLRGEPMPSELKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagaccggtgcgactcatgaaggtgttcgtcacccgcaggatacccgccgagggtagg
gtcgcgctcgcccgggcggcagactgtgaggtggagcagtgggactcggatgagcccatc
cctgccaaggagctagagcgaggtgtggcgggggcccacggcctgctctgcctcctctcc
gaccacgtggacaagaggatcctggatgctgcaggggccaatctcaaagtcatcagcacc
atgtctgtgggcatcgaccacttggctttggatgaaatcaagaagcgtgggatccgagtt
ggctacaccccagatgtcctgacagataccaccgccgaactcgcagtctccctgctactt
accacctgccgccggttgccggaggccatcgaggaagtgaagaatggtggctggacctcg
tggaagcccctctggctgtgtggctatggactcacgcagagcactgtcggcatcatcggg
ctggggcgcataggccaggccattgctcggcgtctgaaaccattcggtgtccagagattt
ctgtacacagggcgccagcccaggcctgaggaagcagcagaattccaggcagagtttgtg
tctacccctgagctggctgcccaatctgatttcatcgtcgtggcctgctccttaacacct
gcaaccgagggactctgcaacaaggacttcttccagaagatgaaggaaacagctgtgttc
atcaacatcagcaggggcgacgtcgtaaaccaggacgacctgtaccaggccttggccagt
ggtaagattgcagctgctggactggatgtgacgagcccagaaccactgcctacaaaccac
cctctcctgaccctgaagaactgtgtgattctgccccacattggcagtgccacccacaga
acccgcaacaccatgtccttgttggcagctaacaacttgctggctggcctgagaggggag
ccgatgcctagtgaactcaagctgtag

DBGET integrated database retrieval system