KEGG   Homo sapiens (human): 9380Help
Entry
9380              CDS       T01001                                 

Gene name
GRHPR, GLXR, GLYD, PH2
Definition
(RefSeq) glyoxylate and hydroxypyruvate reductase
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00620  Pyruvate metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
Disease
H00117  Primary hyperoxaluria (HP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    9380 (GRHPR)
   00630 Glyoxylate and dicarboxylate metabolism
    9380 (GRHPR)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    9380 (GRHPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     9380 (GRHPR)
    1.1.1.81  hydroxypyruvate reductase
     9380 (GRHPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored KR IlvN Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 9380
NCBI-ProteinID: NP_036335
OMIM: 604296
HGNC: 4570
Ensembl: ENSG00000137106
Vega: OTTHUMG00000019914
Pharos: Q9UBQ7(Tbio)
UniProt: Q9UBQ7
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9p13.2
AA seq 328 aa AA seqDB search
MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLS
DHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLL
TTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRF
LYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVF
INISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHR
TRNTMSLLAANNLLAGLRGEPMPSELKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagaccggtgcgactcatgaaggtgttcgtcacccgcaggatacccgccgagggtagg
gtcgcgctcgcccgggcggcagactgtgaggtggagcagtgggactcggatgagcccatc
cctgccaaggagctagagcgaggtgtggcgggggcccacggcctgctctgcctcctctcc
gaccacgtggacaagaggatcctggatgctgcaggggccaatctcaaagtcatcagcacc
atgtctgtgggcatcgaccacttggctttggatgaaatcaagaagcgtgggatccgagtt
ggctacaccccagatgtcctgacagataccaccgccgaactcgcagtctccctgctactt
accacctgccgccggttgccggaggccatcgaggaagtgaagaatggtggctggacctcg
tggaagcccctctggctgtgtggctatggactcacgcagagcactgtcggcatcatcggg
ctggggcgcataggccaggccattgctcggcgtctgaaaccattcggtgtccagagattt
ctgtacacagggcgccagcccaggcctgaggaagcagcagaattccaggcagagtttgtg
tctacccctgagctggctgcccaatctgatttcatcgtcgtggcctgctccttaacacct
gcaaccgagggactctgcaacaaggacttcttccagaagatgaaggaaacagctgtgttc
atcaacatcagcaggggcgacgtcgtaaaccaggacgacctgtaccaggccttggccagt
ggtaagattgcagctgctggactggatgtgacgagcccagaaccactgcctacaaaccac
cctctcctgaccctgaagaactgtgtgattctgccccacattggcagtgccacccacaga
acccgcaacaccatgtccttgttggcagctaacaacttgctggctggcctgagaggggag
ccgatgcctagtgaactcaagctgtag

DBGET integrated database retrieval system