KEGG   Homo sapiens (human): 9469Help
Entry
9469              CDS       T01001                                 

Gene name
CHST3, C6ST, C6ST1, HSD
Definition
carbohydrate (chondroitin 6) sulfotransferase 3 (EC:2.8.2.17)
Orthology
K01020  
chondroitin 6-sulfotransferase 3 [EC:2.8.2.17]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Disease
H00762  
SEMD, Omani type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    9469 (CHST3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.17  chondroitin 6-sulfotransferase
     9469 (CHST3)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9469 (CHST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
10q22.1
AA seq 479 aa AA seqDB search
MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALA
DANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKE
EEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGAN
AAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKK
VFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLV
RDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPA
WLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKN
SSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggactcactttgccccaggactgccgggactttgtgcacagcctgaagatg
agaagcaaatacgcccttttcttggtttttgtggtgatagtttttgtcttcatcgaaaag
gaaaataaaatcatatcaagggtctcagacaagctgaagcagattccccaagctctagca
gatgccaacagcaccgacccagccctgatcttagctgagaacgcatctctcttgtccctg
agcgagctcgattcagccttctcccagcttcagagccgtctccgcaacctcagcttgcag
ctgggcgtggagccagccatggaggccgcaggggaggaagaggaagagcagagaaaggag
gaggagccgcccagaccggccgtggcggggccccggcgccacgtgctgctcatggccacc
acgcgcaccggctcctcgttcgtgggcgagttcttcaaccagcagggcaacatcttctac
ctcttcgagccgctgtggcacatcgagcgcacagtgtccttcgagccggggggcgccaac
gccgcgggctcggccctggtgtaccgcgacgtgctcaagcagctcttcctgtgcgacctg
tacgtgctggagcacttcatcacgccgctgcccgaggaccacctgactcagttcatgttc
cgccggggctccagccgctccctgtgcgaggaccccgtctgtacgcccttcgtcaagaag
gtcttcgagaagtaccactgcaagaaccgccgctgcggccccctcaacgtgacgctggcc
gcagaggcctgccgccgcaaggagcacatggccctcaaggcggtgcgcatccggcagctg
gagttcctgcagccgctggccgaggacccccgcctggacctgcgcgtcatccagctggtg
cgcgacccccgggccgtgctggcctcgcgcatggtggccttcgccggcaagtataagacc
tggaagaagtggctggacgacgagggccaggacggcctgagggaagaggaggtgcagcgg
ctgcggggcaactgcgagagcatccgcctgtccgcggagctggggctgcggcagcccgcc
tggctgcggggccgctacatgctggtgcgctacgaggacgtggcacgcgggccgctgcag
aaggcccgcgagatgtaccgcttcgccggcatccccctgaccccgcaggtggaagactgg
atccaaaagaacacgcaggcggcccacgacggcagcggcatctactccacgcagaagaac
tcctcggagcagttcgagaagtggcgcttcagcatgcccttcaagctggcccaggtggtg
caggccgcctgcggccctgccatgcgcctcttcggctacaaactggcgcgggacgccgcc
gccctcaccaaccgctcagtcagcctgctggaggagaggggcaccttctgggtcacgtag

DBGET integrated database retrieval system