KEGG   Homo sapiens (human): 958Help
Entry
958               CDS       T01001                                 

Gene name
CD40, Bp50, CDW40, TNFRSF5, p50
Definition
CD40 molecule, TNF receptor superfamily member 5
Orthology
K03160  
tumor necrosis factor receptor superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Malaria
Toxoplasmosis
HTLV-I infection
Epstein-Barr virus infection
Transcriptional misregulation in cancer
Asthma
Autoimmune thyroid disease
Systemic lupus erythematosus
Allograft rejection
Primary immunodeficiency
Viral myocarditis
Disease
H00086  
Hyper IgM syndromes, autosomal recessive type
H00093  
Combined immunodeficiencies (CIDs)
Drug target
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
20q12-q13.2
AA seq 277 aa AA seqDB search
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtctgcctctgcagtgcgtcctctggggctgcttgctgaccgctgtccatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccagccaggacagaaactggtgagtgactgcacagagttcactgaaacggaatgcctt
ccttgcggtgaaagcgaattcctagacacctggaacagagagacacactgccaccagcac
aaatactgcgaccccaacctagggcttcgggtccagcagaagggcacctcagaaacagac
accatctgcacctgtgaagaaggctggcactgtacgagtgaggcctgtgagagctgtgtc
ctgcaccgctcatgctcgcccggctttggggtcaagcagattgctacaggggtttctgat
accatctgcgagccctgcccagtcggcttcttctccaatgtgtcatctgctttcgaaaaa
tgtcacccttggacaagctgtgagaccaaagacctggttgtgcaacaggcaggcacaaac
aagactgatgttgtctgtggtccccaggatcggctgagagccctggtggtgatccccatc
atcttcgggatcctgtttgccatcctcttggtgctggtctttatcaaaaaggtggccaag
aagccaaccaataaggccccccaccccaagcaggaaccccaggagatcaattttcccgac
gatcttcctggctccaacactgctgctccagtgcaggagactttacatggatgccaaccg
gtcacccaggaggatggcaaagagagtcgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system