KEGG   Homo sapiens (human): 958Help
Entry
958               CDS       T01001                                 

Gene name
CD40, Bp50, CDW40, TNFRSF5, p50
Definition
CD40 molecule, TNF receptor superfamily member 5
Orthology
K03160  
tumor necrosis factor receptor superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Malaria
Toxoplasmosis
HTLV-I infection
Epstein-Barr virus infection
Transcriptional misregulation in cancer
Asthma
Autoimmune thyroid disease
Systemic lupus erythematosus
Allograft rejection
Primary immunodeficiency
Viral myocarditis
Disease
H00086  
Hyper IgM syndromes, autosomal recessive type
H00093  
Combined immunodeficiencies (CIDs)
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    958 (CD40)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    958 (CD40)
   04514 Cell adhesion molecules (CAMs)
    958 (CD40)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    958 (CD40)
   04672 Intestinal immune network for IgA production
    958 (CD40)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    958 (CD40)
  Immune diseases
   05310 Asthma
    958 (CD40)
   05322 Systemic lupus erythematosus
    958 (CD40)
   05320 Autoimmune thyroid disease
    958 (CD40)
   05330 Allograft rejection
    958 (CD40)
   05340 Primary immunodeficiency
    958 (CD40)
  Cardiovascular diseases
   05416 Viral myocarditis
    958 (CD40)
  Infectious diseases
   05166 HTLV-I infection
    958 (CD40)
   05169 Epstein-Barr virus infection
    958 (CD40)
   05144 Malaria
    958 (CD40)
   05145 Toxoplasmosis
    958 (CD40)
Cellular antigens [BR:hsa04090]
 Proteins
  958 (CD40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
20q12-q13.2
AA seq 277 aa AA seqDB search
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtctgcctctgcagtgcgtcctctggggctgcttgctgaccgctgtccatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccagccaggacagaaactggtgagtgactgcacagagttcactgaaacggaatgcctt
ccttgcggtgaaagcgaattcctagacacctggaacagagagacacactgccaccagcac
aaatactgcgaccccaacctagggcttcgggtccagcagaagggcacctcagaaacagac
accatctgcacctgtgaagaaggctggcactgtacgagtgaggcctgtgagagctgtgtc
ctgcaccgctcatgctcgcccggctttggggtcaagcagattgctacaggggtttctgat
accatctgcgagccctgcccagtcggcttcttctccaatgtgtcatctgctttcgaaaaa
tgtcacccttggacaagctgtgagaccaaagacctggttgtgcaacaggcaggcacaaac
aagactgatgttgtctgtggtccccaggatcggctgagagccctggtggtgatccccatc
atcttcgggatcctgtttgccatcctcttggtgctggtctttatcaaaaaggtggccaag
aagccaaccaataaggccccccaccccaagcaggaaccccaggagatcaattttcccgac
gatcttcctggctccaacactgctgctccagtgcaggagactttacatggatgccaaccg
gtcacccaggaggatggcaaagagagtcgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system