KEGG   Homo sapiens (human): 9939Help
Entry
9939              CDS       T01001                                 

Gene name
RBM8A, BOV-1A, BOV-1B, BOV-1C, C1DELq21.1, DEL1q21.1, MDS014, RBM8, RBM8B, TAR, Y14, ZNRP, ZRNP1
Definition
RNA binding motif protein 8A
Orthology
K12876  
RNA-binding protein 8A
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9939 (RBM8A)
  Translation
   03013 RNA transport
    9939 (RBM8A)
   03015 mRNA surveillance pathway
    9939 (RBM8A)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    9939 (RBM8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 174 aa AA seqDB search
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtgctagatcttcacgaggctgggggcgaagatttcgccatggatgaggat
ggggacgagagcattcacaaactgaaagaaaaagcgaagaaacggaagggtcgcggcttt
ggctccgaagaggggtcccgagcgcggatgcgtgaggattatgacagcgtggagcaggat
ggcgatgaacccggaccacaacgctctgttgaaggctggattctctttgtaactggagtc
catgaggaagccaccgaagaagacatacacgacaaattcgcagaatatggggaaattaaa
aacattcatctcaacctcgacaggcgaacaggatatctgaaggggtatactctagttgaa
tatgaaacatacaaggaagcccaggctgctatggagggactcaatggccaggatttgatg
ggacagcccatcagcgttgactggtgttttgttcggggtccaccaaaaggcaagaggaga
ggtggccgaagacgcagcagaagtccagaccggagacgtcgctga

DBGET integrated database retrieval system