KEGG   Homo sapiens (human): 9939Help
Entry
9939              CDS       T01001                                 

Gene name
RBM8A, BOV-1A, BOV-1B, BOV-1C, C1DELq21.1, DEL1q21.1, MDS014, RBM8, RBM8B, TAR, Y14, ZNRP, ZRNP1
Definition
RNA binding motif protein 8A
Orthology
K12876  
RNA-binding protein 8A
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 174 aa AA seqDB search
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtgctagatcttcacgaggctgggggcgaagatttcgccatggatgaggat
ggggacgagagcattcacaaactgaaagaaaaagcgaagaaacggaagggtcgcggcttt
ggctccgaagaggggtcccgagcgcggatgcgtgaggattatgacagcgtggagcaggat
ggcgatgaacccggaccacaacgctctgttgaaggctggattctctttgtaactggagtc
catgaggaagccaccgaagaagacatacacgacaaattcgcagaatatggggaaattaaa
aacattcatctcaacctcgacaggcgaacaggatatctgaaggggtatactctagttgaa
tatgaaacatacaaggaagcccaggctgctatggagggactcaatggccaggatttgatg
ggacagcccatcagcgttgactggtgttttgttcggggtccaccaaaaggcaagaggaga
ggtggccgaagacgcagcagaagtccagaccggagacgtcgctga

DBGET integrated database retrieval system