KEGG   Homo sapiens (human): 9939Help
Entry
9939              CDS       T01001                                 

Gene name
RBM8A, BOV-1A, BOV-1B, BOV-1C, C1DELq21.1, DEL1q21.1, MDS014, RBM8, RBM8B, TAR, Y14, ZNRP, ZRNP1
Definition
(RefSeq) RNA binding motif protein 8A
  KO
K12876  RNA-binding protein 8A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Module
hsa_M00430  Exon junction complex (EJC)
Disease
H01847  Thrombocytopenia-absent radius syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9939 (RBM8A)
  Translation
   03013 RNA transport
    9939 (RBM8A)
   03015 mRNA surveillance pathway
    9939 (RBM8A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     9939 (RBM8A)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    9939 (RBM8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 RRM_5
Motif
Other DBs
NCBI-GeneID: 9939
NCBI-ProteinID: NP_005096
OMIM: 605313
HGNC: 9905
Ensembl: ENSG00000265241
Vega: OTTHUMG00000013736
Pharos: Q9Y5S9(Tbio)
UniProt: Q9Y5S9 A0A023T787
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 174 aa AA seqDB search
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtgctagatcttcacgaggctgggggcgaagatttcgccatggatgaggat
ggggacgagagcattcacaaactgaaagaaaaagcgaagaaacggaagggtcgcggcttt
ggctccgaagaggggtcccgagcgcggatgcgtgaggattatgacagcgtggagcaggat
ggcgatgaacccggaccacaacgctctgttgaaggctggattctctttgtaactggagtc
catgaggaagccaccgaagaagacatacacgacaaattcgcagaatatggggaaattaaa
aacattcatctcaacctcgacaggcgaacaggatatctgaaggggtatactctagttgaa
tatgaaacatacaaggaagcccaggctgctatggagggactcaatggccaggatttgatg
ggacagcccatcagcgttgactggtgttttgttcggggtccaccaaaaggcaagaggaga
ggtggccgaagacgcagcagaagtccagaccggagacgtcgctga

DBGET integrated database retrieval system