KEGG   Herbinix luporum: SD1D_0938Help
Entry
SD1D_0938         CDS       T04072                                 

Definition
(GenBank) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hsd  Herbinix luporum
Brite
Enzymes [BR:hsd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SD1D_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:1015663..1016244
Genome map
AA seq 193 aa AA seqDB search
MIQKVGFHYTDDITVINRQQFEAHIRLYGGYVDKINEIDQILMNNPEREKANATFSFYRE
CKRGETYALNGVILHELYFENIGGIVNKPDKRAMEQLAMYFGSFEGWKEDFISTAKASRG
WALLSYDQRSLRLRNISLDAHDLGNIAYSAPILVLDVYEHAYFLQYADNKVEYINRFMEN
INWEVISDRMGIY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaggttggatttcattataccgatgatataactgtaataaatcgtcagcag
tttgaggcacatataagattgtatgggggatatgtagataagatcaatgaaattgatcag
atacttatgaataatccggaaagagaaaaggccaatgctacctttagcttctatagagaa
tgcaaaagaggtgaaacctatgcccttaatggggtaattctacatgagctttattttgag
aatataggtggtattgtaaacaaaccggataaaagagctatggagcagcttgctatgtat
tttggcagctttgagggatggaaagaagattttataagtacagcaaaggctagcaggggc
tgggcacttcttagttacgaccaaagaagtttaagactgcgaaatatcagtttagatgcc
catgatcttggtaatattgcatactctgccccaatccttgtgctggatgtatatgaacat
gcctattttctgcaatatgcagataataaagtagagtatatcaataggtttatggagaat
atcaattgggaagtaatatccgacagaatggggatttactaa

DBGET integrated database retrieval system