KEGG   Herbaspirillum seropedicae SmR1: Hsero_2382Help
Entry
Hsero_2382        CDS       T01268                                 

Definition
(GenBank) acyltransferase family protein
Organism
hse  Herbaspirillum seropedicae SmR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2711511..2714309)
Genome map
AA seq 932 aa AA seqDB search
MPDPTKPSPEDSALDRVLQLVQQMVDETAPNRHYVITPHTSFEKDLALDSLSRVELMLRV
GRAFGVETSPAMLSEVDSAQDLLRFIGTTASRQPRASSALDKAPTVGVPDHAQTLLEMLE
WHADHQAGKVHILLIDEQHREQEIRYCDLLDDAKMVATALLQGGLLPKQTVALMLPTSRD
YLACFFGILFAGGIPVPIYPPARLSRIDDQLRRHHHILSNSEAVFIVTLAEAKPFARMLQ
AKLPGLMSILTPAELKSSAGFLRYRPSRDDIAFIQYTSGSTGDPKGVTLTHANLLSNVRA
LGKVSRVSPSDIFVSWLPLYHDMGLIGAWFGSLYHGIPLVLMSPMTFLAQPSIWLDQLSR
HRGTISAAPNFAYELCLRHVNDALLSSLDLSCWRLALNGSEPVSATTLASFAKRFEGCGL
RYRAMTPVYGLAECSVGLSFPVLDADPRIDSISRQLLAREGKALHPDSADAADTIKVPSC
GPALPGHQIRVVDDAGFELPSRCVGRLEFRGPSATHGYYRNPKATANLFHDGWLDSGDYA
YLAEGEVYIVGRIKDLIKRGGRNLYPYDLEQAVSHVRGIRRGGVAVFGSNDPENGAERLV
IVAETEIQDTKLQASMRRAVHEASIDVIGEPPDDVVFVPPHWVLRTSSGKIRRLACKAAY
EEGRVSHRFSMSWQTTAGLASRAVAARIATMARTTGRLAYALYAWVTFGLLTAILAPAVV
ILQRPRQGRRIAHHGSQLLVRLLALQVSIAGTDHLPSGPHVLVVNHSSYLDSLILLAALP
PVPGYCLAAKRELEAHWIIRRFLRGLGVLFVDRSDISQSRTEVDSMVEALKRGENILVFP
EGTFTRNAGLNAFHFGAFMAASKANVPLVVAGLRGTRLALRDESWILRRIAIAFEVGEML
KPTGSDWTATILMSANARKLMIPLTGEFDAAI
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatccgactaagccatcaccggaagactcggccctggatcgagtcctgcagctt
gtacagcagatggtggacgagactgctccaaaccgccattacgtaatcacaccacatacc
tcattcgaaaaagatctggcactggacagtctgtcgcgcgtggaactgatgttgcgtgtc
gggcgcgccttcggcgtggaaacatcgccagccatgctctcggaggtggactcggcacaa
gatcttctgcgcttcataggaaccacagcgtcacgacagccgcgtgcatccagcgctcta
gataaggcgccaaccgtcggcgtgccggatcatgcccagacgttgctggagatgctggag
tggcatgcggatcatcaggccggcaaggtccatatcttgctgatcgatgaacagcatcgc
gaacaggaaatccgctactgcgacctgcttgatgacgcaaagatggtggccaccgccttg
ctgcaaggaggactgctgccgaagcagactgtcgcattgatgttgccgacatcccgggat
tatctggcctgctttttcggcatattgtttgccggtggcataccggtgcccatatatcct
ccagcacggctgagtcgcatcgacgatcaactgcgacgtcatcaccatatactgtcgaat
tccgaggcggtcttcattgtcactctcgctgaagcaaaaccgtttgcgcggatgttgcag
gcaaagttgccgggtctgatgtccatactgacgccggcagaattgaaatcctcagctggc
tttctacgctatcgtccttctcgagacgacatcgcgtttatccaatatacctccggaagc
acaggagatcccaagggcgtcacgctcacgcatgcaaacttgctctccaacgtcagggcc
ttggggaaggtatcgagggttagtccaagcgacatcttcgtttcctggctgcccctgtat
cacgatatgggacttatcggcgcatggttcggctctttgtaccatggcattccattggtg
ctgatgtctccgatgaccttcctggcgcaaccctcgatctggctggatcagttgtctcgt
catcgcggcacgatttccgctgcacccaatttcgcctacgagttgtgtctgcgccatgtc
aatgacgcattgctgtcctcgctggacttgtcttgctggcggcttgcgctcaatggatcg
gaacccgtcagcgccacaacgctggcttcctttgcgaaacgcttcgagggatgtggtctc
cgatatcgcgccatgacgcctgtctatggccttgccgaatgttcggtcggcttgtcgttc
ccggtcttggacgcagatccgcggatagacagcatctcgcgtcagttattggcgcgtgaa
ggaaaggccctccatccagacagtgctgatgctgccgacacaataaaagtcccttcatgc
ggaccagcactgcccggacaccagatcagggtggtcgacgatgccggatttgaattgcca
tcacgctgcgtcgggcgtctggagttcagggggccttctgcaacacatggctactatcgc
aatccgaaagccactgcaaacctgtttcacgacggctggcttgattcgggagactatgct
tacctcgcggaaggggaggtctatatcgtgggccgcatcaaggatctgatcaagcgtggc
ggaagaaatctctatccctatgatctggagcaggcagttagccatgtccggggtattcgt
agggggggtgtcgcagtgtttggcagcaacgatcccgaaaacggggctgaacgcctggtc
attgttgccgaaaccgagatacaggacacgaagctgcaggcctccatgcggcgcgctgtg
catgaagcttcgattgatgtcatcggagagccgcctgatgatgtcgtttttgttccgcca
cactgggtattgaggacttccagcggaaagatcagacgccttgcgtgtaaagcggcatat
gaagagggcagggtatcgcatcgcttcagtatgtcttggcagactactgcaggtctggcg
tcaagggccgtcgccgcacgtatcgcgacgatggcgaggacgaccggcaggctagcttat
gcgctttacgcctgggtgactttcggattgctgacagccatcctggcgccagccgtggtc
atcttgcaaagaccgaggcaggggcgtcgcattgctcatcatggttctcaactcttggtg
cgcttactcgccctgcaagtgagtattgcaggaaccgatcacctgccatccggaccgcat
gtgctggtggtcaatcacagtagctatcttgacagcctcatcttgctggccgcgcttcct
cccgttccgggctattgcctggcggcaaagcgcgaactcgaagcacattggatcattcgt
cggtttctgcgcggtcttggcgtgctgtttgtggatcgctcggacatctcacagagcagg
acggaggttgactccatggtggaagccctcaagcgtggtgaaaatatcctggtctttcca
gaagggacattcacacgaaatgcaggcctcaacgcctttcactttggcgctttcatggcc
gcgtcaaaggccaacgttcctcttgtggtcgcgggcctgcgcggcacgcgccttgccctt
cgggatgagagctggatactgcgtcgtattgcgattgccttcgaggtgggcgaaatgctg
aagcctaccggtagcgactggaccgccacgatcctcatgtccgccaacgcacggaaattg
atgatcccgctcacgggagagtttgacgcggccatctag

DBGET integrated database retrieval system