KEGG   Herbaspirillum seropedicae SmR1: Hsero_4283Help
Entry
Hsero_4283        CDS       T01268                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Hsero_4283 (gst)
Enzymes [BR:hse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Hsero_4283 (gst)
Transporters [BR:hse02000]
 Other Transporters
  Pores ion channels [TC:1]
   Hsero_4283 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4900833..4901534)
Genome map
AA seq 233 aa AA seqDB search
MQDTELDPVLSETLQKAGRHLPTLVIANKNYSSWSMRPWVAMVAFDIPFKEVRLLLDQAD
TAAEIARYTGSGRVPVLLDGDIAIWDSLSICEYLAEQFPDRHLWPARTDARAIARSICAE
MHSGFTGLRSAMSMDIRGRYPGQGRTAEAQADIARVCEIWEECLSQFGHHDFLFGDFSIA
DAFYAPVVMRFISYQVPLAPALQAYADRVREHPAVARWIAEALAEKEILPDHK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatactgaacttgatccggtattgtccgaaacgctgcaaaaagccggccgccat
ctgcccacgctggtgatcgccaacaagaactactcgtcctggtccatgcgcccatgggtc
gccatggtggccttcgacattcccttcaaggaagtgcgactgttgctggaccaggccgac
accgccgccgagatcgcccgctacaccggctcgggccgggtgccggtgctgctcgatggc
gacatcgccatctgggattcgctgtccatctgtgaatacctggccgagcaattccctgac
cgccacctgtggccggcgcgcaccgatgcgcgcgccattgcgcgcagcatctgcgccgag
atgcattccggcttcaccggcctgcgcagcgccatgagcatggacatccgcgggcgctac
ccgggccagggccgtacggccgaggcgcaggccgatatcgcccgcgtctgcgagatctgg
gaagagtgcctctcgcaattcggccaccatgatttcctcttcggtgatttctccatcgcc
gacgccttctacgccccggtggtgatgcgcttcatcagctatcaggtgccgctggccccg
gcgctgcaggcctatgccgaccgcgtgcgcgaacacccggccgtggcgcgctggatcgcc
gaagcgctggccgagaaggaaatccttccggaccacaagtga

DBGET integrated database retrieval system