KEGG   Halomonas aestuarii: BOX17_12570Help
Entry
BOX17_12570       CDS       T04554                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
hsi  Halomonas aestuarii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX17_12570
  Amino acid metabolism
   00310 Lysine degradation
    BOX17_12570
   00380 Tryptophan metabolism
    BOX17_12570
Enzymes [BR:hsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BOX17_12570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2726550..2729378
Genome map
AA seq 942 aa AA seqDB search
MQEGIMELMWRSSHVSGGNAHYVEALYEQYLDDPSAVPDEWRQYFDQLPRPEGGASHDVP
LSPVRDQFYQLGQQRRTAHAAADSGEGKKQVKVLQLINAYRFRGHQKADIDPLGLRSPTP
VPDLDLSFHQLSKADLDTEFQTGSFFMGQDKASLKEIVSALEQTYCRSIGCEVMHIVDTE
EKRWLQQRFESVRSAPKFSPAVRKHVLERLTAAEGLESYLASKYPGTKRFGLEGGECFIP
MMDELIQRAGSYGTKEVVIGMAHRGRLNMLVNILGKNPSELIDEFDGKKVIERGSGDVKY
HQGFSSNVMSPGGEVHLALSFNPSHLEIVAPVVEGSVRARQDRRNDPVGDKVLPINVHGD
AAFAGQGVVMETFQMSQTRAYRTGGTLHIVINNQVGFTTSHPEDSRSTEYCTDIAKMVQA
PIFHVNGDDPDAVLHATQVALDYRQQFKRDVVIDLVCYRRRGHNEADEPSGTQPMMYNKI
KDHPSSRTRYVERLVKEGLLSDDDAKAMMEKYRDDLQAGNHVANALVQKPNKSLFVDWTP
YLGHEWTGHADTRVEMKRLQRLAGKMCEIPDGITVQRQVAKIYEDRRKMQAGGMAINWGF
AETLAYATLLDQGHPVRLTGQDVGRGTFSHRHAVVHNQKDGNAYVPLQHMADGQPRFTIH
DSFLSEEAVLAFEYGYSTTAPNDLVIWEAQFGDFFNGAQVVVDQFISSGETKWERLCGLT
MLLPHGYEGQGPEHSSARLERFLQMCAEHNMQVCVPTTPAQIFHLLRRQVIRPLRKPLVV
MSPKSLLRHKSATSRLEELAEGNFQMVLPDQGKLEAKKVERIVLCAGKVYYDLENWREEN
ARDDVAILRIEQLYPFPKEELFEAIKDYTNVEDVVWCQEEPLNQGAWYSSQHHMRAVADM
LRDGLGGKLKFAGRPASAAPAAGYMSVHTEQQRQLVEDAFNL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaggcataatggagttgatgtggcgctcctcccacgtcagtggtggcaatgcc
cactatgtggaagcgctctacgaacagtacctcgatgatccctccgccgttcccgacgaa
tggcgccagtacttcgaccagctaccgcgacccgagggcggtgcctcccacgatgttccc
ctctcaccggtccgcgaccagttctaccagctgggacagcagcgtcgtaccgcgcatgcc
gccgccgacagcggagagggcaagaagcaggtcaaggtactccagctgatcaacgcctac
cgcttccgcgggcaccagaaggccgacatcgatcccctcggcctgcgcagtcccaccccg
gttcccgacctcgacctctccttccaccagctctcgaaggccgacctggacaccgagttc
cagaccggctccttcttcatgggccaggacaaggcgagcctgaaggagatcgtcagtgcg
ctggagcagacctactgtcgctccatcggctgcgaggtcatgcatatcgtcgacaccgag
gagaaacgctggctgcagcagcgcttcgagtcggtgcgcagtgcgccgaagttcagcccc
gccgtgcgcaagcacgtgctcgagcgcctcacggccgccgagggcctggagagctacctg
gcctccaagtacccgggcaccaagcgcttcggcctcgagggtggcgagtgcttcatcccg
atgatggatgagctgatccagcgcgccggcagctatggcaccaaggaagtggtgatcggc
atggcccaccgcgggcgcctcaacatgctggtcaacatcctcggcaagaacccctccgag
ctgatcgacgagttcgacggcaagaaggtcatcgagcggggctccggtgacgtgaagtac
caccagggcttcagctccaacgtcatgtcgccgggcggcgaggtccacctggcgctgtcg
ttcaacccctcccacctggagatcgtggccccggtggtcgagggctcggtgcgcgcccgt
caggatcgccgcaacgacccggttggtgacaaggtgctgccgatcaacgtccatggcgac
gcggccttcgccggccagggcgtggtcatggagaccttccagatgtcccagacccgcgcc
tatcgcaccggcggcaccctgcacatcgtcatcaacaaccaggtgggcttcaccacctcg
cacccggaagactcgcgctccaccgagtactgcaccgacatcgccaagatggtccaggcg
ccgatcttccacgtcaacggcgatgaccccgatgccgtgctgcatgccacccaggtggcg
ctggactaccgccagcagttcaagcgcgacgtggtcatcgacctggtgtgctaccgccgc
cgcggccacaacgaggcggacgagccttccggcacccagccgatgatgtacaacaagatc
aaggaccatccgtcctcgcggacccgctacgtcgagcgcctggtcaaggagggcctgctc
tccgacgacgacgccaaggcgatgatggagaagtaccgggacgacctgcaggccggcaac
cacgtggccaacgccctggtgcagaagcccaacaagtcgctgttcgttgactggaccccc
tacctgggccacgagtggaccggccatgccgacacccgggtcgagatgaagcgcctgcag
cgcctcgccggcaagatgtgcgagattcccgacggcatcaccgtgcagcgccaggtggcc
aagatctacgaggaccgccgcaagatgcaggccggcggcatggccatcaactggggcttc
gccgagaccctggcctacgccacgctgctcgaccagggccatccggtgcgcctcaccggc
caggacgtgggccgcggcaccttctcccaccgccacgcggtggtgcacaaccagaaggac
ggcaacgcctatgtgccgctgcagcacatggccgacggccagccgcgcttcaccatccac
gactccttcctctccgaggaggcggtgctggcgttcgagtacggctattccaccacggcg
cccaacgacctggtgatctgggaagcccagttcggcgacttcttcaacggcgcccaggtg
gtggtggaccagttcatctcctccggcgagaccaagtgggagcgcctctgtggcctgacc
atgctgctgccccacggctacgaggggcaggggcccgagcactcctcggcgcgtctggag
cgcttcctgcagatgtgtgccgagcacaacatgcaggtctgcgtgccgaccacgccggcg
cagatcttccatctgctgcggcgccaggtgatccgcccgctgcgcaagccgctggtggtc
atgtcgcccaagagcctgctgcgtcacaagtcggcgacctcgaggctcgaggagctggcc
gaaggcaacttccagatggtcctccccgaccagggcaagctcgaggcgaagaaggtcgag
cgcatcgtgctgtgtgccggcaaggtctactacgacctggagaactggcgcgaggagaac
gcccgcgacgatgtggccatcctgcgcatcgagcagctctatcccttccccaaggaggag
ctcttcgaggccatcaaggactacaccaacgtcgaggacgtggtgtggtgccaggaggag
ccgctcaaccagggcgcctggtactcgagccagcaccacatgcgggccgtggccgacatg
ctgcgcgatggcctgggcggcaagctcaagttcgccggacgcccggcatcggccgccccc
gcggcgggctacatgtccgtgcacaccgaacagcagcgccagctggtggaagacgccttc
aacctgtga

DBGET integrated database retrieval system