KEGG   Halobacterium salinarum: OE_4169FHelp
Entry
OE_4169F          CDS       T00662                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hsl  Halobacterium salinarum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OE_4169F (ppcA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    OE_4169F (ppcA)
   00680 Methane metabolism
    OE_4169F (ppcA)
Enzymes [BR:hsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OE_4169F (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1668875..1670353
Genome map
AA seq 492 aa AA seqDB search
MVDVPRLMSTQHPDNATLPFFTAGDVIEGEDEIQEAYYVYSHLGCDEQMWDFEGKEGDEY
AVKKLLSRYDEFFADHQLGTDVRLTVRGPNPDVEGSEAKILLEILESIPRSFDAARRFAG
EYGLETTAPIFEVIVPMVTDADQLNAVHEYYERFVTGKADEAVWDGRTVEEWVGEFDPAS
ITVIPLIEEREAMLAADDIVREYATAHDQDAVRVFLARSDPALNYGCLAADLINKVALQR
LYEMSEATGVDVHPILGAGSAPFRGNLTPERAAATADAYSEVETFTVQSAFKYDYPVETV
RDGVATLRDADLGAPPFPIDEARALAVIDRTADAYADQVDAIAGTVNRLSSYVPDRRARK
LHVGLFGYAREVGENALPRAIGYTASLYAVGCPPTLLGAHALTDDDAAFVREAFPAYFDH
LADAARYFNPRCTDVLDLDDDTLAAAVERVDVTPNSEHRAATDDAIDALQRGDDDALRSA
IRRGARERQFLG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgtgccgcgactgatgagcacgcaacatccggacaacgccacactcccgttc
ttcaccgccggcgacgtgatcgagggcgaggacgaaatacaggaggcctactacgtgtac
tcgcatctgggctgcgacgaacagatgtgggacttcgagggcaaggagggcgacgagtac
gccgtcaagaagctgctctcgcggtacgacgagttcttcgcggaccaccagttggggacg
gacgtgcggctgaccgttcgcggcccgaaccccgacgtggaggggtccgaggcgaagatc
ctgctggagatcctggagagcatcccgcggtcgttcgacgccgcgcggcgcttcgccggc
gagtacgggctggagacgaccgcgccgatcttcgaggtcatcgtgccgatggtgaccgac
gccgaccagctcaacgccgtccacgagtattacgagcggttcgtgaccgggaaggccgac
gaggcggtctgggacggcagaacggtcgaggagtgggtgggggagttcgatccggcgtcg
atcacggtcatcccgttgatcgaggagcgggaggcgatgctggcggccgacgacatcgtc
cgcgagtacgcgaccgcccacgaccaggacgccgtccgggtgtttctcgcgcgctcggac
cccgcgttgaactacggctgtctggccgccgacctcatcaacaaggtcgctctgcagcgc
ctctacgagatgagcgaagccaccggcgtcgacgtccacccgatcctgggcgcggggtcg
gcgccgttccgcgggaacctcaccccggagcgcgcggccgcgaccgccgacgcctacagc
gaggtggagacgttcaccgtgcagtcggcgttcaaatacgactatcccgtggagacggtc
cgcgacggggtcgccacgctccgtgacgcggacctgggtgcgcccccgttccccatcgac
gaggcgcgcgcgctggccgtcatcgaccggaccgcggacgcgtacgccgaccaggtggac
gccatcgcggggacggtcaaccggctgtcgtcgtacgtgcccgaccggcgcgcccgcaag
ctccacgtcgggctgttcggctacgcccgcgaggtcggggagaacgcgctcccgcgggcc
atcggctacacggcgtcgctgtacgcggtgggctgcccgccgacgctgctgggcgcgcac
gcgctcaccgacgacgacgcggcgttcgtgcgcgaggcgttcccggcgtacttcgaccac
ctcgcggacgccgcgcggtatttcaacccacggtgtacggacgtgctcgacctcgacgac
gacacgctggcggccgccgtcgagcgcgtggacgtcaccccgaacagcgagcaccgcgcc
gccaccgacgacgccatcgacgccctccagcgcggcgacgacgacgccctgcggtcggcg
atccgtcggggggcgcgtgagcgacagttcctcgggtga

DBGET integrated database retrieval system