KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105189946Help
Entry
105189946         CDS       T03918                                 

Definition
(RefSeq) hexokinase type 2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105189946
   00051 Fructose and mannose metabolism
    105189946
   00052 Galactose metabolism
    105189946
   00500 Starch and sucrose metabolism
    105189946
   00520 Amino sugar and nucleotide sugar metabolism
    105189946
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105189946
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105189946
Membrane trafficking [BR:hst04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105189946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 473 aa AA seqDB search
MKTKNGSLFSKICCSGKATSREHKVSHLNATSEIRDACKDLVLSDEQLRLVMQKLTDEIN
RGLSSETHDDAIVKCFTTYVQDLPNGTEKGNFLALDLGGTNFRVLLITLDGQSFDMKSKI
YAIPQSLMLGTGTQLFDHIAQCLALFVNDLKLQNEVLPLGFTFSFPLNQHGLTNGNLVRW
TKGFNCSGVIGENVVALLEEAIDRRNDVKIDVCAILNDTTGTLMSCAWKNRNCRIGLIVG
TGSNACYVEKTKNVQCATPGNYAAHKPDMVINTEWGAFGEGGVLDFVTTEFDRAIDENSI
NSTRQLFEKMISGMYMGELTRLVLEKLVDAGLLFGGKCPSDLRKRGKFFTKYVSEIENDP
KGKYTNCRDVLAELGLRNVSDQDCENVRYVCSVVSRRAAYLVSAGIAALLNKMGENDVTV
GIDGSVYRYHPHFHDLMVAKIGELQNYKFDLMLSEDGSGRGAALVAAVASQNR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaagaatggatcgttgtttagcaagatatgctgcagcgggaaagcaacatcg
cgggagcacaaagtttctcatttgaatgcaacgtccgagatacgagatgcctgcaaggac
ctcgtcctgtccgacgagcagctcaggctagtcatgcaaaagctcaccgacgagatcaac
agaggcctgtccagtgagactcacgacgatgcgatcgtcaagtgtttcactacgtacgtg
caggacttaccgaacggcaccgagaagggtaactttttggcgctagatctgggcggcacg
aatttccgggtgttgctgatcacgttggatggccaaagcttcgatatgaaaagcaagatt
tatgcgataccccaaagcctgatgctgggcacggggacccagctattcgatcacatcgcg
caatgtttggcactgtttgtaaacgacctaaaactgcaaaacgaggtgttgcccttgggc
ttcacattcagctttccgctcaatcagcacggactgacgaacggcaatctagtgaggtgg
accaagggattcaactgtagtggcgtgatcggtgagaacgtggtcgcgcttctcgaagaa
gcgatcgacagaaggaatgacgtcaagattgacgtgtgcgcgatcctgaacgacaccacc
ggcactctaatgtcgtgcgcttggaagaatcgtaactgccggatcggcttgatcgttggt
accgggagtaacgcctgctacgtcgagaaaacgaagaatgtgcaatgcgcgaccccgggt
aattacgccgcgcacaagcccgacatggtaatcaacacggaatggggtgctttcggcgag
ggcggtgtgctggatttcgttacgaccgagttcgaccgtgccatcgacgaaaattccatc
aactcgacgaggcagctgtttgaaaaaatgatttcgggcatgtacatgggcgaactgacg
agattggtcctcgagaagctcgtcgacgccggtcttctgttcggcggcaagtgtcccagt
gacctcagaaagcgtggcaagttcttcacgaaatacgtctccgagatagaaaacgaccct
aagggcaagtatacgaattgtcgcgatgtgctggccgaattaggactgcggaacgtgagt
gatcaagactgtgagaatgtgaggtatgtgtgctcggtagtgtcgaggcgggcggcgtac
ttggtgagcgcgggaatcgcggcacttctgaataagatgggcgagaatgacgtcacggta
ggcatcgacggctcggtgtatcgctaccatccgcactttcacgatcttatggtagccaag
atcggtgaactccagaattacaagtttgacctgatgctctcggaagatggcagcggccgt
ggtgcagcactcgtcgccgcagtggcgtcgcagaatcggtga

DBGET integrated database retrieval system