KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105191541Help
Entry
105191541         CDS       T03918                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hst00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    105191541
   00650 Butanoate metabolism
    105191541
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105191541
   00280 Valine, leucine and isoleucine degradation
    105191541
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105191541
Enzymes [BR:hst01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105191541
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105191541
Amino acid related enzymes [BR:hst01007]
 Aminotransferase (transaminase)
  Class III
   105191541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 497 aa AA seqDB search
MLVNKCTLAARASPRQLLNGVATWRRCLTGSTSSREPARPVVATEIPGPQSRNMLQELNA
IQQASSVQFFVDYEKSVGNYIVDVDGNALLDVYMQISSMPLGYNHPAMLEALADPVNQKI
MANRPALGVFPGSQWAERLNRVLLKSGVAPPGLSHLTTMMCGSCSNENAFKNIFIWYAEK
RRQGAPFTEQEMESCMMNQIPGSPRFCIMSFKGAFHGRTLATLSTTHSKYIHKMDIPAFD
WPIASFPEYKYPLEENMRHNQQEDKRCLAEVEGLFEKFEKEKKTPVAGVIIEPIQSEGGD
NHASPEFFQELQRITKKNGAALLIDEVQTGGGPTGKMWCHEHFCLDAPPDLVTFSKKMQL
GGYYHMKAFKPKQPYRVFNTWMGDPSKVILLEAILDVIKKENLLDRVTHVGDYVMKHLMD
MQKGHSGKISAVRGRGTFIAFNCASPEIRDALIKKLQTKGIQTGGCGQQAVRLRPALTFT
KHHADIFLDALRSSLKE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttaacaagtgcacgctggccgcgcgtgcctcgccccgacagctactcaatggc
gttgcaacctggaggagatgcttaaccggttccacgtcgtcgagagaaccagcaaggccg
gtagtcgcgacggagataccgggtcctcagtcgcgcaatatgctgcaggaattgaacgcg
atacaacaagcctcttccgtacaattcttcgtagactacgagaaatccgtcggcaattac
atcgtggacgtcgacgggaacgcgctgctggacgtttacatgcaaatctcatcgatgccc
ttagggtacaatcatccggctatgttggaggctctcgccgatcccgttaatcagaaaatc
atggcgaaccgaccggccttaggcgtctttccgggcagtcagtgggctgaaagattgaac
agggttctgctgaagagcggggtcgctccgcccggattgtcgcatctcacgacgatgatg
tgcggctcctgctccaatgaaaacgccttcaagaacatattcatctggtacgccgagaaa
cgaagacaaggcgcgccgttcaccgagcaggagatggaatcctgcatgatgaatcagatt
cctggctcaccgcggttctgcatcatgtctttcaaaggagcattccacggtagaactctg
gccactttgtcgaccacccacagcaagtacattcacaagatggatataccagccttcgat
tggcctatcgcttccttccccgaatacaaatatcccttggaggagaatatgcggcataat
caacaggaggataaacgttgtctcgcagaggtcgagggactgtttgagaaatttgagaag
gagaagaaaacaccggtggccggtgtgataattgagcctattcaatcagaaggcggtgac
aatcacgcgtcgcccgagttctttcaggaactgcaacgcataaccaagaagaatggggcg
gcgcttcttatcgatgaagtgcaaaccggtggtgggccaacagggaagatgtggtgccac
gagcacttctgcctagacgccccacccgacttggtgaccttcagcaagaagatgcaattg
ggcggttattatcacatgaaagctttcaagccgaaacaaccgtatcgcgtgttcaacact
tggatgggcgatcccagtaaggtgatcttgctagaagcgatcctcgatgtgataaagaag
gagaatcttttggacagggtgacgcacgtcggtgattatgtgatgaaacatctaatggat
atgcaaaaggggcattccggtaagataagcgcggtgcgcggacgcggtacgtttatagcg
tttaattgcgcctcacctgagattcgagacgctcttatcaagaagcttcaaaccaaaggt
atccaaacgggcggctgcggccaacaagctgtgcgactcaggcccgcgttgactttcacg
aagcatcacgccgacatatttttggacgcgctccgctctagcctaaaggaataa

DBGET integrated database retrieval system