KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105191653Help
Entry
105191653         CDS       T03918                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
Enzymes [BR:hst01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105191653
Peptidases [BR:hst01002]
 Metallo Peptidases
  Family M2
   105191653
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105191653
CD molecules [BR:hst04090]
 Proteins
  105191653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105191653
NCBI-ProteinID: XP_011153490
LinkDB All DBs
Position
Un
AA seq 696 aa AA seqDB search
MEHVFGRTGRVPDVDRAGRSFIKWTLVLCLLSMVSAQLDLPPYRNDIPDGPARQFPSNEL
DYRNILARLDFLGAERCSANVLAQWTYETDVNEYTQLQALEAQRLYADFQNQAWHLISRI
DRNAVRDPTIRRRLRYLSVVGPSALPPDQLDRYNRLINDMLAVYNGATICAYNDPFRCGL
RLYPDISQIMAKSRDWDELQYVWTEWRRRSGAPIRDLYQQLVTLNNEAARLNNFTDAAEY
WMFPYESPDFQQDVDEVWEMIRPLYEELHAYVRRRLRDLYGPEKISGHAPLPSHILGNVW
GQSWSNLLDVTLPYPGKTYLDVTQEMQAQGYTPIDMFRVAQDFYLSMNLSAMPPEFWAGS
ILVDPGNRPLICQASAWDFCNRLDYRIKMCTKVTMKDLITIHHEMAHIQYFLRYSGLPRE
FRDGANPGFHEAVGEAVALSVATPRHLQTLDLANKYIDERAADINYLFSLAMEKLVLLPF
SIAMDRWRWDVFRGYVNREEYNCHWHRLMEQYTGTKPPVLRSEDDFDPGAKYHIPANIPY
IRNFVAGVLQFQLYRALCQAAGQRFVDDPRRPLHKCDFYKNPEAGRILGTLMERGSSIPW
QETLREVTNEFRLDGSALREYFRPLEDWLRTENLRTGEVVGWSYDGDYCKRSIETAGLQV
YGSGFYNGATSICASWVATSILAMTLWIVSLFHRAQ
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgtgttcggtagaaccggcagggtgccggacgtggaccgcgccggtcgaagc
ttcataaaatggacgctcgtactgtgcctgttatcgatggtttcggctcaattggacttg
ccaccgtacagaaacgacattcccgacggtccggcgcggcagtttccctccaatgaattg
gattaccgtaatatcctagccagattggactttctcggtgcggaaagatgcagcgctaac
gttttggcacaatggacatacgaaaccgacgttaacgaatacacgcagctacaagcgctg
gaggcccaacggctgtacgcggactttcagaaccaagcgtggcacttgatctcaagaatc
gaccggaacgcagtccgggatcccacgatcagacgacgtctcaggtacctgtccgtcgtg
gggccctcggcgttgcctcccgatcagttggacaggtacaatcggctgatcaacgacatg
cttgcggtctacaacggggcgaccatatgcgcctacaacgatcctttccgatgcggacta
cgcttatatccagacatatcacaaatcatggcgaaaagtcgagactgggacgagttgcag
tacgtttggaccgagtggagaagacgaagcggtgcaccgattagggatctctatcagcaa
ctcgttacgctgaacaatgaagcggcgagattgaacaacttcaccgacgccgccgagtac
tggatgttcccgtatgagtctcctgatttccaacaggacgttgacgaggtttgggaaatg
attcgtccgctctacgaagaactgcacgcttatgtccgcaggagattgcgagatctatac
ggcccggaaaagataagcggacacgcgcctcttccgtctcacattctcggcaacgtgtgg
ggacaatcttggagcaatcttttggacgtcaccttgccgtatcctggaaaaacgtatctc
gacgtcactcaggagatgcaagctcaaggctacacgccaatcgacatgtttcgagtagcc
caggatttctatctgtccatgaacttgagcgccatgccgccggagttttgggccggaagt
atactcgtcgatcctggcaatcgtccgttaatctgccaagcatccgcgtgggacttttgc
aaccgcttggattataggattaaaatgtgcacgaaagtgacgatgaaggatctgataact
atacaccacgagatggcacatatccaatacttcttgcgatacagcggtctacctcgcgaa
tttcgtgacggcgcgaatccagggttccacgaggctgtcggcgaggctgtcgctttgagc
gtcgcgacgccgcgtcacctgcagaccctggacctggcgaacaaatacatcgatgagcgc
gcggccgacatcaattacctcttctccttggcgatggagaagctcgtgctgctgcccttc
agcatcgcgatggacaggtggcggtgggacgtttttcgcggttacgtcaacagggaggag
tacaattgccactggcacaggctgatggagcagtacacgggcacgaaaccgccggtgctg
aggtccgaggacgactttgatccaggcgctaagtatcatatcccggccaatattccgtac
atacggaattttgtggccggcgtccttcaattccagctttatcgcgcgctgtgccaagcg
gcggggcagcgattcgtcgacgaccccaggaggccgctgcacaagtgtgacttctacaag
aacccggaagccggcagaatcctggggacactcatggagagaggctcgtccatcccgtgg
caggagacgctccgagaggtcaccaacgagttcaggctggacggatccgctcttagggag
tacttccggccgttggaggattggctgaggacggagaatttgcggacgggcgaagtcgtc
ggctggtcttacgatggagattactgcaagaggagcatagagaccgcgggcttgcaggtt
tacgggagcggcttctacaacggcgcgacctcgatctgcgcgtcctgggtcgcgactagt
atcctcgcgatgaccctttggatcgtgtcgctgttccatcgggcgcaatga

DBGET integrated database retrieval system