KEGG   Hymenobacter swuensis: Hsw_2716Help
Entry
Hsw_2716          CDS       T03055                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hsw  Hymenobacter swuensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Hsw_2716
  Lipid metabolism
   00600 Sphingolipid metabolism
    Hsw_2716
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Hsw_2716
Enzymes [BR:hsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Hsw_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3065504..3067978)
Genome map
AA seq 824 aa AA seqDB search
MFRPFSWPALALLCVVSVPAAAQTRQETLLTTDWKFTKGDVPEASQPDFKDAKWQTVSVP
HDWAIYGPFDGNNDLQTVKIEQNQEQKATQKAGRTGGLPFIGTGWYRRQLTVPSFGPGKR
AVLLFDGAMSDAHVFVNGKEVGAWPYGYNSFSCDITDALRPDGRNVLAVRLRNQPEASRW
YPGAGLYRNVHLVVTQDVHVPVWGTYLTTPEINANSAKVKLRTKVETPGIAAQSLRLETE
IRDAAGQVVATTTTTLAPPSGQEFEQNLVVPKPQLWSPETPVLYSASSKLYSGDVLKDEY
RTSFGIRSFRFEANKGFSLNGQPRKFKGVCNHHDLGPLGAAVNTAALRRQLTLLKDLGCD
AIRTTHNMPAPELVTLCDEMGFMLIVESFDEWKKPKVKNGYSQYFDAWSEKDLVNMVHHY
RNNPSVIMWSIGNEVPDQWAPGGVAIAQRLQDIVHREDPTRPVTAGMDQFDAAVGNGFAA
LLDVPGFNYKPSRYPEARAKLPQGFMLGSETASTVSSRGVYKFPVELAKQKKYPDNQSSS
YDLEACVWSQTPDEEFVQQDALPYLMGEFVWTGFDYLGEPTPYDEAWPSHSSYFGIMDLA
GLPKDRYYLYRSRWNTASPTLHLLPHWTWPGREGQTTPVYCYTNYPSAELFVNGVSQGRQ
SKAPSDKLQTQFRLMWNDVKYAPGSIKVVAYDAAGKAVAEEEVRTAGQPHHLRLVADHNR
LTADGQDLAYITARVEDAQGNLCPNATNQVQFTVRGQGRFRAVANGDATSLELFHQPRMH
AFHGQLVATVQATTQAGSVEVKATAKGLPGAVLKLETGSASAPK
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcctttctcttggcccgcactggcccttctgtgcgtagtatccgttcctgcc
gctgcgcaaacccgtcaggaaaccctgctgaccaccgactggaaattcaccaaaggggat
gtgcccgaggcctcccaacctgattttaaagatgccaagtggcagaccgtgagcgtgccc
cacgactgggccatctacggcccatttgatggcaacaacgacttgcaaaccgtcaagatt
gagcagaaccaagagcagaaggctacccagaaggccggccgcaccggcgggctgcccttc
attggtaccggctggtaccgtcggcagctgacggtgcccagttttgggcccggtaagcgg
gccgtgctgctgtttgatggggccatgagcgacgcgcatgtattcgtgaacggcaaggaa
gtgggggcctggccctacggctacaactccttctcctgcgacattaccgacgcgctccgg
cccgatggccggaacgtgctggccgtgcggctgcgtaaccagccggaagcctcgcgctgg
taccccggtgcgggcctgtatcggaacgtgcacctggtagtaacccaggatgtgcacgtc
ccggtgtggggaacttacctcactacgcccgaaatcaacgccaactctgccaaggtaaag
ctgcgcacgaaggtggaaacccccggcatcgccgcgcagtcgttgcgcctggaaacggaa
atccgggacgcggccgggcaggtagtggctaccaccacgaccacgctggccccccccagc
gggcaggaattcgagcagaacctagtggtacccaaaccgcagctttggtcgccggaaacg
ccggttctttactccgcgtcctcgaagctctacagtggcgacgtgctgaaggatgagtac
cggacgtcgttcgggattcgttcgttccggtttgaggccaacaagggcttctccctgaac
gggcagccgcgcaagttcaaaggcgtatgcaaccaccacgacctaggcccgctgggcgcg
gccgtgaatacggccgcgttgcgccgtcagctgaccctgctgaaagacttgggctgcgac
gccatccggaccacccacaatatgcccgccccggagctggtaacgctttgcgacgaaatg
ggcttcatgctgattgtagagtcgtttgatgagtggaaaaagcccaaagtaaagaacggc
tacagccagtatttcgacgcgtggtcggagaaggacctggtgaatatggtgcaccactac
cgcaataatccgtcggttatcatgtggagcatcggcaatgaggtgcccgaccagtgggcg
cctggcggtgtggccattgcgcagcggctgcaggatattgtgcaccgcgaagaccccacc
cgccccgtcacggccggcatggatcagtttgacgcggctgtgggcaacggcttcgcggcc
ctgctcgatgtgccgggcttcaactacaagcccagccgttaccccgaagcccgcgccaag
ctgccccagggctttatgctgggctccgaaacggcctctacggtgagcagccggggcgtg
tacaagtttccggtagaattggccaagcagaaaaaataccccgataatcaatcctcgtcc
tatgacctagaggcctgtgtgtggtcccagacgcccgacgaggaatttgtgcagcaggat
gcgctgccgtacctgatgggcgaattcgtgtggaccggtttcgactacctgggcgagccc
acgccctacgacgaggcctggccctcgcacagttcctacttcggtatcatggacctggcg
ggcctgcctaaagaccggtactacctctaccgctcccgctggaataccgccagccccacg
ctgcacctgctgccccattggacctggcccggccgcgagggccagacgacgcccgtgtac
tgctacaccaactacccctcggccgagctgttcgtgaatggtgtaagccagggccgccag
agtaaagctccttctgataagctccagacgcagttccgcctgatgtggaacgacgtgaaa
tacgcgcccggtagcattaaggtggtggcgtacgatgccgctggcaaggcggtggcggaa
gaggaagtgcgcactgccggccagcctcaccacctccggctggtagctgaccacaaccgc
ctcacggccgatggtcaggacttggcgtacataacggcccgcgtggaggatgcgcagggc
aacctttgccctaatgccaccaatcaggtgcagttcactgtgcgcggccagggccggttc
cgggccgttgccaacggtgacgcgaccagcctggagctgtttcatcaaccccggatgcac
gctttccacggccagttggtggctacggtgcaggcgactacccaagccggttcggtggag
gtgaaggcaactgccaaaggcctgccaggcgcggtgctgaagctggaaacaggcagcgca
tcggctcctaaataa

DBGET integrated database retrieval system