KEGG   Halorhabdus tiamatea: HTIA_2780Help
Entry
HTIA_2780         CDS       T02781                                 

Definition
(GenBank) manganese/iron superoxide dismutase [Mn]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hti  Halorhabdus tiamatea
Brite
Enzymes [BR:hti01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HTIA_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2805076..2805702
Genome map
AA seq 208 aa AA seqDB search
MEEIHMSERSNPELPSLPYDYDALEPHISEQVLEWHHDTHHQGYVNGLDAAEETLAENRA
SGDHSTTGGALGNVTHNGSGHYLHTLFWENMSPNGGGEPEGALLERIEEDFGSYDAWKAE
FEAAAGAAGGWALLVYDPVAKQLRNVAVDKHDNGALWGSHPILALDVWEHSYYYDYGPDR
GSFIDAFFEVLNWEKVAEEYQKSLDHFE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaattcacatgtccgaacgttcaaaccccgaactgccgtccctgccgtacgac
tacgacgccctcgagccgcacatctccgagcaggtcctggagtggcatcacgacacccac
catcagggctacgtgaacggtctcgacgccgccgaggagaccctcgccgagaaccgcgcg
tcgggcgatcacagcacgaccggcggcgcgctgggtaacgttacccacaacggctccggt
cactacctgcacacgctgttctgggagaacatgtccccgaacggcggtggcgaacccgag
ggcgctctcctggaacggatcgaggaggacttcggctcctacgacgcctggaaggccgag
ttcgaggccgcagccggtgccgcgggtggctgggcactgttggtctatgaccctgtcgcc
aagcaactccggaacgtcgcggtcgacaaacacgacaacggtgcgctgtggggctcccac
ccgatcctggcgctcgacgtctgggagcactcctactactacgactacggaccggaccgc
ggcagcttcatcgacgccttcttcgaggtcctcaactgggagaaagtcgccgaggagtac
cagaagtccctcgatcacttcgagtaa

DBGET integrated database retrieval system