KEGG   Haloterrigena turkmenica: Htur_2522Help
Entry
Htur_2522         CDS       T01154                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
htu  Haloterrigena turkmenica
Brite
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Htur_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2597117..2597719)
Genome map
AA seq 200 aa AA seqDB search
MTDHELPPLPYDYDALEPALSEQVLTWHHDTHHQGYVNGLNSAEETLAENREEGDYSSTP
GALSDVTHNGCGHYLHTLFWENMSPNGGGEPEGDLADRIEEDFGSYEGWKGEFQKAAGAA
GGWALLVYDPVAKQLRNLAVDKHDQGALWGAHPVLALDVWEHSYYYDYGPDRGEFIDAFF
DVVNWEKAEEEYQTCLDHFE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccacgaacttccaccacttccgtacgactacgacgcgcttgaaccggcactt
tccgagcaggtcctgacctggcaccacgacacccaccatcagggctacgtgaacggcctg
aactcggccgaggagaccctcgcggagaaccgcgaggagggcgactacagttcgacgccc
ggtgccctctcggacgtcacccacaacggctgtggccactatctccacacgctgttctgg
gagaacatgtcccctaacggcggcggcgagcccgagggcgacctcgccgaccgcatcgag
gaggacttcggctcctacgagggctggaagggcgagttccagaaggccgccggcgccgcc
ggtggctgggccctgctggtctacgacccggtcgccaagcagctgcgcaacctcgcggtc
gacaagcacgaccagggcgcgctctggggcgcccatcccgtgctcgcgctggacgtctgg
gaacactcctactactacgactacggtccggaccgtggcgagttcatcgacgccttcttc
gacgtcgtcaactgggagaaggccgaagaggagtaccagacctgcctcgaccacttcgag
taa

DBGET integrated database retrieval system