KEGG   Haloquadratum walsbyi DSM 16790: HQ_2675AHelp
Entry
HQ_2675A          CDS       T00375                                 

Gene name
glpA2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HQ_2675A (glpA2)
Enzymes [BR:hwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HQ_2675A (glpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1963756..1965009
Genome map
AA seq 417 aa AA seqDB search
MTIQTDVAIIGGGATGAGIARDLALRGVDVSLFERGGLGGGTSGRSHGLLHSGGRYAESD
PIGAEECIRESRILRDIAEGCIRETGGLFVQLESDDPAYFEEKLEACNELDIPTETISAE
EAHERVPGLTEDVERAFTVPDGVIYPSRLVVANAADAREHGASIYTHTPVESVTTANGEI
TELHVGGEINDTVEATQIVNATGAWAEVMGEDLGVDVSMQPTRGVMISVEYDGLDPVLNR
CRDPDDGDIIVPHDGEVVLGTTSVAVEDPDDYEEADWEVERSVDECAELIPDITDAPEVR
TWWGVRPLYEPDEDERDDGRGISRGFFVINHAERNEPANLISVVGGKLTTYRQMAEAASD
QICARLGVDASCETDERPLHASDDPAQLDALIDEFDAVNPTDRDIVTTATPAESAAD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccaaacagatgttgcaataatcggcggcggagcgactggtgctggaattgct
cgtgatctcgcacttcgtggcgttgatgtatcactctttgagcgtggtggacttggcgga
ggcacctccgggcgctcacatggattgttacatagtggtggtcgatacgcagagtctgac
ccaattggtgctgaggaatgcatccgcgaaagtcgaattcttagggatatcgctgaggga
tgtattcgtgagactggaggattattcgttcaacttgagtcagatgatcctgcatacttc
gaggaaaaactcgaagcctgtaatgaacttgatattccgactgaaacaattagtgctgag
gaggcacacgaacgcgttcccgggctaactgaggatgttgaacgggcatttaccgtccct
gatggggtgatctatccatcacgacttgttgttgccaatgctgcagacgctcgtgaacac
ggtgcatcaatttatacacatacccctgttgagtcggtcacgactgctaatggagaaatc
acagaattacacgtcggaggtgagattaacgataccgttgaagcaacacaaattgtcaac
gctaccggtgcgtgggcagaggtaatgggtgaggatcttggtgtcgatgtctcaatgcaa
ccaacgcgtggagtgatgatctcagttgaatatgatgggcttgacccagttttgaatcga
tgtcgtgaccctgatgatggtgatattatcgtcccacatgatggtgaagtcgtacttggg
acaacaagcgttgcagttgaagatccagatgattatgaggaagctgactgggaggtcgag
cgatctgttgatgaatgtgcggaattgatcccggatattacagacgctccagaagtccga
acctggtggggtgttcgcccactgtacgagcctgatgaagatgagcgcgatgatggtcgt
ggtatctcacgtggcttctttgtcatcaatcatgctgaacgcaacgaaccggcaaatctt
atttcagttgttggtgggaaactcaccacatatcgacagatggcagaggcagcaagcgat
caaatctgtgcgagacttggtgttgatgcatcgtgtgaaaccgatgagcggccattacat
gcttcggatgacccagcacaacttgatgcactaatcgatgaatttgatgcagtcaatccg
actgatcgagatattgtgactacagccacgcctgcagaatccgccgcagactaa

DBGET integrated database retrieval system