KEGG   Halopiger xanaduensis: Halxa_2169Help
Entry
Halxa_2169        CDS       T01532                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00010  Glycolysis / Gluconeogenesis
hxa00053  Ascorbate and aldarate metabolism
hxa00071  Fatty acid degradation
hxa00280  Valine, leucine and isoleucine degradation
hxa00310  Lysine degradation
hxa00330  Arginine and proline metabolism
hxa00340  Histidine metabolism
hxa00380  Tryptophan metabolism
hxa00410  beta-Alanine metabolism
hxa00561  Glycerolipid metabolism
hxa00620  Pyruvate metabolism
hxa00625  Chloroalkane and chloroalkene degradation
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_2169
   00053 Ascorbate and aldarate metabolism
    Halxa_2169
   00620 Pyruvate metabolism
    Halxa_2169
  Lipid metabolism
   00071 Fatty acid degradation
    Halxa_2169
   00561 Glycerolipid metabolism
    Halxa_2169
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Halxa_2169
   00310 Lysine degradation
    Halxa_2169
   00330 Arginine and proline metabolism
    Halxa_2169
   00340 Histidine metabolism
    Halxa_2169
   00380 Tryptophan metabolism
    Halxa_2169
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Halxa_2169
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halxa_2169
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Halxa_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEH36794
JGI: Halxa_2169
UniProt: F8D8P0
LinkDB All DBs
Position
complement(1492990..1494480)
Genome map
AA seq 496 aa AA seqDB search
MVDSISIEADWGAQYIDGEWTAGESEETIAVEDPSTREPVAEVPAGVEADVDAAYEAAAA
AQEEWKDQPPARRAEVIRQFHEAVEEHSEEIVDLLAHEVGGSRIMGETSIHIAGDHATEA
ETLPRRMKGEHAASNIPGKENIVQREAKGVVTVISPWNFPLNLSMRAVAPAIAAGNSVVL
KPSTNSPITGGLLFAKLFEETDLPDGVLNVVTGRGSEIGDRVASHPESDVVAFTGSTEVG
QHVASLAGENLAVPAMELGGNNAFVVTDDADLERALDGATFGSFVHQGQVCISINRHIVH
EDIYDEYVERLTERAEELPVGSAHDADTIVGPIIDESQRDEMLEYVEETVDQGATLETGG
KTIPVEGVDDSLVVAPTVLSDVTNDMAAACNEHFGPIAPVIPFSDIDEAVEIANATEFGL
SGAVHAGDLEVAKDIADRMETGNVHINDQPINDEAHVPFSGIGASGMGTYNSDAFLREIT
ETKWISIQHEAREYPF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacagcatctctatcgaagccgactggggcgcccagtacatcgacggcgaatgg
accgcgggcgagagcgaggagacgatcgcggtcgaggatccgtcgacccgcgagccggtc
gcggaggtccctgccggcgtcgaggccgacgtcgacgcggcgtacgaggcggccgccgcc
gcgcaggaagagtggaaggaccaaccgccagcgcggcgagccgaggtcattcggcagttc
cacgaggcggtggaggaacacagcgaggagatcgtcgacctgctggcccacgaggtcggc
gggtcgcggatcatgggcgagacgtccatccacatcgccggcgaccacgccaccgaggcg
gagacgctcccgcggcggatgaagggcgaacacgccgcctcgaacatccccggcaaggag
aacatcgtccagcgcgaggcgaagggcgtcgtaacggtcatctcgccgtggaacttcccg
ctgaacctctcgatgcgagccgttgcgcccgccatcgccgcgggcaacagcgtggtgctt
aagccgtcgacgaactccccgatcacgggcgggctcctgttcgcgaagctgttcgaggag
accgacctccccgacggcgtcctcaacgtcgtcaccggccgcgggagcgagattggcgac
cgcgtcgcgagtcatcccgaaagcgacgtcgtcgccttcaccggctcgaccgaagtcggc
cagcacgtcgcttcgctcgccggcgagaacctcgccgtccccgcgatggaactgggcggc
aacaacgccttcgtcgtgaccgacgacgccgacctcgagcgcgcgctcgacggcgcgacc
ttcggctcgttcgtccaccaaggacaggtctgtatctcgatcaaccgccatatcgtccac
gaggacatttacgacgagtacgtcgagcgcctgaccgaacgcgccgaggagctgcctgtc
ggcagcgcccacgacgcggacacgatcgtcggcccgatcatcgacgagtcccagcgcgac
gagatgctcgagtacgtcgaggagaccgtcgatcagggcgcgaccctcgagaccggcggg
aagacgattcccgtcgagggcgtggacgactcgctggtcgtcgcgccgacggtcctctcg
gacgtgaccaacgacatggccgccgcgtgcaacgagcacttcggccccatcgcgccggtc
atcccgttctcggatatcgacgaggccgtcgagatcgcgaacgcgaccgagttcggtctc
tccggcgccgtccacgccggcgacctcgaggtcgcgaaggacatcgccgaccgcatggag
accggcaacgtccacatcaacgaccagccgatcaacgacgaggcccacgtgcccttcagc
ggcatcggcgcctccgggatggggacgtacaacagcgacgcgttcctccgcgagatcacc
gagacgaagtggatctcgatccagcacgaggcgcgggagtaccccttctaa

DBGET integrated database retrieval system