KEGG   Hydrogenophaga sp. PBC: Q5W_13645Help
Entry
Q5W_13645         CDS       T04491                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:hyb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Q5W_13645
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Q5W_13645
Transporters [BR:hyb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Q5W_13645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2877640..2878509
Genome map
AA seq 289 aa AA seqDB search
MNTTTETLEPIRLATPAAPPAALPNWIKAAARGFMTHVLPPLVIIGLLLVIWELLGSRPG
AALPPPSKVVQDTWELIVSPFYDNGGNDVGLAWQMLASLKRVAYGYTLAVIAGVSLGVLV
GQSTWALRGLDPLFQVLRTVPPLAWLPISLAGFRDGHPSAIFVIFITAIWPIIINTSIGI
RNIPDDYRNVARVIRLNGVEYFGKIMLPAAAPFIFSGLRIGVGLSWLAIVAAEMLIGGVG
IGFFIWDAWNSSRISDIILALFCVGIVGFLLDRIVAFIGHLVTRGTAAS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccacggaaaccctcgagccgatccggctggccacgcccgccgcacccccg
gccgccctgcccaactggatcaaggccgccgcgcgcggcttcatgacgcacgtgctgccg
ccgctggtgatcatcggcctgctgctggtcatctgggagctgctgggctcgcgcccgggc
gcggcgctgccgccaccgagcaaggtggtgcaagacacctgggagctcatcgtgagcccc
ttctacgacaacggcggcaacgacgtgggtctggcctggcagatgctcgccagcctcaag
cgcgtggcctacggctacacgctggcggtgatcgccggcgtcagcctgggggtgctggtg
gggcagtccacctgggcgctgcgcgggctcgacccgctgttccaggtgctgcgcaccgtg
ccgccgctggcctggctgccgatctccctggccggcttccgcgacggccacccctcggcc
atcttcgtcatcttcatcaccgccatctggccgatcatcatcaacacctccatcggcatt
cgcaacatccccgacgactaccgcaacgtcgcgcgcgtgatccggctcaacggcgtggag
tacttcggcaagatcatgctgcccgccgccgcgcccttcatcttctcggggctgcgcatc
ggcgtgggcctgtcctggctggccatcgtcgcggccgagatgctgatcggcggcgtgggc
atcggcttcttcatctgggacgcctggaacagctcgcgcatcagcgacatcatcctcgcg
ctcttctgcgtcggcatcgtcggcttcctgctcgaccgcatcgtcgccttcatcggccac
ctcgtcacgcgcggcaccgccgcgagctga

DBGET integrated database retrieval system