KEGG   Hymenobacter sp. DG25B: PK28_04925Help
Entry
PK28_04925        CDS       T03500                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00020  Citrate cycle (TCA cycle)
hyd00480  Glutathione metabolism
hyd01100  Metabolic pathways
hyd01110  Biosynthesis of secondary metabolites
hyd01120  Microbial metabolism in diverse environments
hyd01130  Biosynthesis of antibiotics
hyd01200  Carbon metabolism
hyd01210  2-Oxocarboxylic acid metabolism
hyd01230  Biosynthesis of amino acids
Module
hyd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hyd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hyd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PK28_04925
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PK28_04925
Enzymes [BR:hyd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PK28_04925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIZ63195
UniProt: A0A0A7LIX4
LinkDB All DBs
Position
complement(1137499..1138764)
Genome map
AA seq 421 aa AA seqDB search
MAEQKITIKNGKLNVPDQPTIPFIEGDGTGPDIWAASVKVFDAAVEKAYGGKRKLMWKEV
LAGEKAFKQLNNWLPNETLDAFREYLVGIKGPLTTPVGGGIRSLNVALRQELDLYACVRP
VRWFQGVPSPVKHPELTDMVIFRENTEDIYAGIEYMNGTPQAQKMLEFLQDEMGVKKIRF
PETSSFGIKPVSKEGTERLVRAAIQYAIDNKKPSVTIVHKGNIMKFTEGAFKTWGYELAE
REFGDKVYTWSQYDKAAAKQGQDVADAQQKAALESGKILIKDSIADAFLQQILLRPSEYS
VVATLNLNGDYISDALAAIVGGIGIAPGANINYVTGHAIFEATHGTAPKYANQDKVNPGS
VILSGALMLEYMGWQEAADLIYKGIEAAIASKRVTYDFERLMEGATLLKCSEFGDEIIKD
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaaaaaatcaccatcaagaacggcaagctgaacgtacccgaccaacctacc
attccctttattgagggcgacggtacgggtccggacatttgggcggcttccgttaaagtg
tttgacgcggcagtggaaaaagcctacggcggcaagcgcaagctgatgtggaaggaagtg
ctggcgggagaaaaggctttcaagcaactcaataactggctgcccaacgaaacgctggat
gccttccgcgaatacctggtgggtattaaaggtcccctcaccacgcccgtaggcggcggc
attcgctccctgaacgtagctctgcgccaagagctggacctgtatgcctgcgtgcgcccc
gtacgctggttccagggcgtgccttcacccgtgaagcaccccgagctgacggacatggtt
atcttccgcgaaaacacggaggatatctacgccggcattgagtatatgaacggcacgcct
caagcccagaaaatgctggaattcctgcaggatgagatgggcgtgaagaaaatccgcttc
cccgagacttcctccttcggcatcaagcccgtttccaaggaaggcacggagcgcctggtg
cgcgccgccattcagtacgccattgataacaagaagccttccgtgaccattgtgcacaaa
ggcaatatcatgaagttcaccgagggtgccttcaaaacctggggttacgagctggccgag
cgggagtttggcgacaaagtgtacacctggagccagtacgacaaagccgcggccaagcag
ggccaggacgtagccgatgcccagcagaaggcagccctggaaagcggcaaaatccttatc
aaggacagcattgccgatgccttcctgcagcagattctgctccgcccctccgagtactcg
gtagtggctaccctgaacctgaacggcgactatatctccgatgccctggccgccattgtg
ggcggtatcggcattgcgcccggtgctaacattaactacgtaaccggccacgccattttt
gaggccacccacggcacggcgcccaagtacgccaaccaggacaaagtgaaccccggctca
gttatcctctcaggggcactaatgctggagtacatgggctggcaggaagccgccgacctc
atctacaaaggcatcgaagccgccattgcctccaagcgcgtcacctacgacttcgagcgt
ttgatggaaggcgctaccctgctaaagtgctcggagtttggcgacgagattatcaaggat
atgtaa

DBGET integrated database retrieval system