KEGG   Hymenobacter sp. DG25A: AM218_11300Help
Entry
AM218_11300       CDS       T04064                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hye  Hymenobacter sp. DG25A
Pathway
hye00020  Citrate cycle (TCA cycle)
hye00480  Glutathione metabolism
hye01100  Metabolic pathways
hye01110  Biosynthesis of secondary metabolites
hye01120  Microbial metabolism in diverse environments
hye01130  Biosynthesis of antibiotics
hye01200  Carbon metabolism
hye01210  2-Oxocarboxylic acid metabolism
hye01230  Biosynthesis of amino acids
Module
hye_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hye_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hye00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM218_11300
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AM218_11300
Enzymes [BR:hye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AM218_11300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Ntox14
Motif
Other DBs
NCBI-ProteinID: ALD21685
UniProt: A0A0M3RVR5
LinkDB All DBs
Position
2639388..2640653
Genome map
AA seq 421 aa AA seqDB search
MAEQKITIKNGKLNVPDQPTIPFIEGDGTGPDIWAASVKVFDAAVAKAYGGKRKLVWKEV
LAGEKSFKQTGNWLPNETLDAFREYLVGIKGPLTTPVGGGIRSLNVALRQELDLYACVRP
VRWFQGVPSPVKHPELTDMVIFRENTEDIYAGIEYMNGTPQAQKMLEFLQDEMGVKKIRF
PETSSFGIKPVSKEGTERLVRAAIQYAIEQKKPSVTIVHKGNIMKFTEGAFKTWGYELAE
REFGDKVYTWSQYDKTAAKQGQDVADAQQKAALESGKILIKDSIADAFLQQILLRPSEYS
VVATLNLNGDYISDALAAIVGGIGIAPGANINYVTGHAIFEATHGTAPKYANQDKVNPGS
VILSGALMLEYMGWQEAADLIYKGIEAAIASKRVTYDFERLMEGATLLKCSEFGDEIIKD
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaaaaaatcaccatcaagaacggcaagctgaacgtaccagaccaacccacc
attcccttcattgagggcgacggtaccggtccggacatttgggcggcttctgttaaagtg
tttgacgcggcagtagcaaaagcctacggcggcaagcgcaagctggtgtggaaagaagtg
ctggccggggaaaagtctttcaagcagaccggcaactggctgcccaacgaaacgctggat
gccttccgtgaatacctggtgggcattaaaggccccctcactacgcccgtaggcggcggt
atccgctccctgaacgtggccctgcgccaggagctggacctgtacgcctgcgtgcgtccc
gtacgttggttccagggtgtgccctcccccgtgaagcaccccgagctgacggacatggtt
atcttccgcgaaaacactgaggatatctacgccggcattgagtacatgaacggcacccct
caggctcagaaaatgctggaattcctgcaggatgagatgggcgtgaagaaaattcgcttc
cccgagacgtcctcgttcggcattaagccggtttccaaggaaggcacggagcgcctggtg
cgcgccgccatccagtacgccattgagcagaagaagccttccgtgaccattgtgcacaaa
ggcaacatcatgaagttcaccgagggtgccttcaaaacctggggttacgagttggctgag
cgcgagttcggcgacaaagtatacacttggagccagtacgataaaaccgccgccaagcag
ggccaagacgtagccgatgcccagcagaaggcagccctggaaagcggcaaaatcctcatt
aaggacagcattgccgatgccttcctgcagcagattctgctccgcccctccgagtactcg
gtagtggctaccctgaacctgaacggcgactatatttccgatgccctggctgccatcgta
ggtggtatcggcattgcgcccggtgctaacattaactacgtaaccggccacgccattttt
gaagctacccacggtacggcgcccaagtacgctaaccaggacaaagtgaaccccggctcg
gttatcctctcgggtgccctgatgctggagtacatgggctggcaggaagccgccgacctc
atctacaaaggcatcgaagccgccattgcctctaagcgcgtcacctacgactttgagcgt
ttgatggaaggcgctaccctgctgaagtgcagcgagttcggcgacgagattatcaaggat
atgtag

DBGET integrated database retrieval system