KEGG   Hydrogenophaga sp. LPB0072: LPB072_09270Help
Entry
LPB072_09270      CDS       T04505                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hyl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LPB072_09270
Enzymes [BR:hyl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LPB072_09270
Transporters [BR:hyl02000]
 Other Transporters
  Pores ion channels [TC:1]
   LPB072_09270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1994654..1995277
Genome map
AA seq 207 aa AA seqDB search
MSELHLYTNPQSRGRIAHWMMEELGQPYQTHWLDYGTTMKAPDFLAINSMGKVPALRHGN
AVITEVAAICAYVADAFPEQGLKPAPGTPESAAYHRWLFFAAGPLEQAVVARSLGWAVPE
GRSAMVGFGSYDDTLNALELALNGAPYVCGERFTAADVYVGSSLGWGLMFGSIEKRPVFE
AYAQRVQSRPAALRANELNEAQMKAQG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattgcatctgtacaccaacccccagtcccgtggacgcatcgctcactggatg
atggaagagctcggtcagccttaccagacccattggctggactacggcaccaccatgaag
gcgcccgattttctggcgatcaactccatgggcaaagtacccgccttgcgccatggcaat
gcggtgatcacagaggtcgcagcgatctgcgcgtatgtggccgatgcctttcccgagcag
ggcttgaaacccgcgccgggtacacccgaaagcgcggcctaccaccgctggctgtttttt
gcagcggggccgttggagcaggcggtggtggcgcggtcgttgggttgggctgtgcctgaa
ggccgcagtgccatggtcgggtttggcagctatgacgacaccttgaatgcgctggagctt
gccttgaacggggcgccctatgtgtgtggcgagcgtttcaccgcagccgatgtgtacgtg
ggttccagtctgggctggggtctgatgtttggaagcatcgaaaagcgccctgtgtttgaa
gcctatgcgcagcgggtgcaaagccgcccggctgcactgcgggccaacgaactcaacgaa
gcgcaaatgaaggcacagggctga

DBGET integrated database retrieval system